SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81551-1|CAB04483.2|  335|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z50863-2|CAA90737.1|  351|Caenorhabditis elegans Hypothetical pr...    28   8.9  

>Z81551-1|CAB04483.2|  335|Caenorhabditis elegans Hypothetical
           protein F56A12.1 protein.
          Length = 335

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = -2

Query: 250 SSGTRLPTHLVDGVAFSATP*LQLSPVPWC*HPHSIPRGFSSTVPRKAESGSPLMPSHFC 71
           S+ +  P+H+ D  + S  P  +LS       P S+    S +V   A   SP +P+  C
Sbjct: 36  SNSSTSPSHISDQFSSSGGPPYELSSHILT--PSSVIPTPSPSVA-SASISSPTIPAFGC 92

Query: 70  NMSQSSLEQV 41
            MS+ S+EQ+
Sbjct: 93  TMSEYSMEQM 102


>Z50863-2|CAA90737.1|  351|Caenorhabditis elegans Hypothetical
           protein C14H10.4 protein.
          Length = 351

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +1

Query: 619 VLKKFFHLYTGSLSSETGRKYTFINASPP 705
           V+  FFH +    S +TG  Y+FI   PP
Sbjct: 269 VVASFFHFFFSKFSWQTGWLYSFICFYPP 297


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,255,162
Number of Sequences: 27780
Number of extensions: 424602
Number of successful extensions: 1263
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1175
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1263
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1935274832
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).