SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   186   2e-47
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   186   2e-47
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   186   2e-47
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       186   2e-47
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       186   2e-47
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       186   2e-47
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       186   2e-47
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   186   2e-47
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   186   2e-47
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   186   2e-47
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   182   3e-46
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   144   4e-35
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   144   4e-35
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   143   9e-35
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   143   9e-35
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...   132   3e-31
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...   109   2e-24
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...   100   1e-21
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...    85   6e-17
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    38   0.008
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    38   0.008
U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p...    33   0.18 
AL132860-21|CAB60518.2|  759|Caenorhabditis elegans Hypothetical...    31   0.72 
AF057032-1|AAC13567.1|  759|Caenorhabditis elegans DNA topoisome...    31   0.72 
U10401-4|AAN65289.1|  937|Caenorhabditis elegans Myc and mondo-l...    30   1.3  
U10401-3|AAA19059.2| 1009|Caenorhabditis elegans Myc and mondo-l...    30   1.3  
AF264757-1|AAK20949.1| 1009|Caenorhabditis elegans Mlx interacto...    30   1.3  
AF213473-1|AAL50027.1|  913|Caenorhabditis elegans basic helix-l...    30   1.3  
Z27078-8|CAH04706.2| 1446|Caenorhabditis elegans Hypothetical pr...    30   1.7  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    29   2.9  
U42848-3|AAA83609.1|  693|Caenorhabditis elegans Hypothetical pr...    28   5.1  
U80030-2|AAG24161.2|  362|Caenorhabditis elegans Serpentine rece...    27   8.9  
U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical pr...    27   8.9  
AF288812-1|AAG10199.1|  566|Caenorhabditis elegans synembryn pro...    27   8.9  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    27   8.9  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    27   8.9  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    27   8.9  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    27   8.9  
AF038608-17|AAC25822.2|  425|Caenorhabditis elegans Hypothetical...    27   8.9  
AC084158-34|AAK68564.1|  566|Caenorhabditis elegans Resistance t...    27   8.9  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGV 152



 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  143 bits (347), Expect = 9e-35
 Identities = 66/71 (92%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGV 152



 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGV 152



 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGV 152



 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  142 bits (343), Expect = 3e-34
 Identities = 64/71 (90%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGV 152



 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 24  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 83

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 84  FNTPAMYVAIQAVLSLYASGRTTGV 108



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 109 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 154



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/27 (88%), Positives = 24/27 (88%)
 Frame = +1

Query: 187 MVGMGQKDSYVGDEAQSKRGILTSNTP 267
           MVGMGQKDSYVGDEAQSKRGILT   P
Sbjct: 1   MVGMGQKDSYVGDEAQSKRGILTLKYP 27


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 54  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 113

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 114 FNTPAMYVAIQAVLSLYASGRTTGV 138



 Score =  106 bits (254), Expect = 2e-23
 Identities = 49/53 (92%), Positives = 50/53 (94%)
 Frame = +1

Query: 109 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT   P
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 57



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 139 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 184


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGV 152



 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  182 bits (442), Expect = 3e-46
 Identities = 81/85 (95%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK+NREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYV IQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVNIQAVLSLYASGRTTGI 151



 Score =  138 bits (334), Expect = 3e-33
 Identities = 64/69 (92%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 93.9 bits (223), Expect = 9e-20
 Identities = 42/46 (91%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLD+GDGV+HTVPIYEGYALPHAI RLDLAGRDLTDY+MKILTERG
Sbjct: 152 VLDTGDGVTHTVPIYEGYALPHAIQRLDLAGRDLTDYMMKILTERG 197


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKI 311
           LKYPIEHGIVTNWDDMEKI
Sbjct: 68  LKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  144 bits (350), Expect = 4e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKI 311
           LKYPIEHGIVTNWDDMEKI
Sbjct: 68  LKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  143 bits (347), Expect = 9e-35
 Identities = 66/71 (92%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKI 311
           LKYPIEHGIVTNWDDMEKI
Sbjct: 68  LKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  143 bits (347), Expect = 9e-35
 Identities = 66/71 (92%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDM 302
           LKYPIEHGIVTNWDDM
Sbjct: 68  LKYPIEHGIVTNWDDM 83


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score =  132 bits (318), Expect = 3e-31
 Identities = 56/86 (65%), Positives = 72/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++YP+EHGIV NW DMEKIW + F  ++L++ PEEHPVLLT+APLNP  NRE+  +I FE
Sbjct: 70  IEYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKNRERSAEIFFE 129

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
           TFN PA+Y+ +QAVLSLYA+GRTTG+
Sbjct: 130 TFNVPALYIQMQAVLSLYATGRTTGV 155



 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 29/46 (63%), Positives = 37/46 (80%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPI +G+A+ HAI R+DLAGRD+T+YL  +L   G
Sbjct: 156 VLDSGDGVTHAVPIVKGFAMKHAIQRMDLAGRDVTEYLRVLLRREG 201



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 28/63 (44%), Positives = 42/63 (66%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G    D ++G +A+S RG+ + 
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAGGLDGDIFIGPKAESNRGLFSI 70

Query: 259 NTP 267
             P
Sbjct: 71  EYP 73


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score =  109 bits (261), Expect = 2e-24
 Identities = 49/87 (56%), Positives = 65/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMF 428
           D+ YP+++GIV NWDDM  +W HTF  E L + P+E  +LLTE PLNP +NREKM Q+MF
Sbjct: 69  DINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKECKLLLTEPPLNPNSNREKMFQVMF 128

Query: 429 ETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E +   ++YVA+QAVL+LYA G  TG+
Sbjct: 129 EQYGFNSIYVAVQAVLTLYAQGLLTGV 155



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 29/46 (63%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YEG+AL H   RLD+AGRD+T YL+K+L +RG
Sbjct: 156 VVDSGDGVTHICPVYEGFALHHLTRRLDIAGRDITKYLIKLLLQRG 201



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           +VVDNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VG+E    R +L
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEECSQLRQML 68

Query: 253 TSNTP 267
             N P
Sbjct: 69  DINYP 73


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score =  100 bits (239), Expect = 1e-21
 Identities = 44/79 (55%), Positives = 55/79 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYPI HGIV +WD ME+ W    +  LR  PE+H  LLTE PLN   NRE   +IMFE+
Sbjct: 81  VKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLTEPPLNTPENREYTAEIMFES 140

Query: 435 FNTPAMYVAIQAVLSLYAS 491
           FN P +Y+A+QAVL+L AS
Sbjct: 141 FNVPGLYIAVQAVLALTAS 159



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 21/51 (41%), Positives = 34/51 (66%)
 Frame = +2

Query: 491 RSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           RS    V+DSGDGV+H +P+ +GY +   I  + +AGRD+T ++  +L +R
Sbjct: 168 RSLTGLVIDSGDGVTHCIPVADGYVIGSCIKHIPIAGRDITYFIQSLLRDR 218



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 162
           M   ++ A V+DNG+G  K G+AG+  P+ + PS +
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAI 36



 Score = 30.7 bits (66), Expect = 0.96
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = -1

Query: 592 VQTQDGVRECVSLVDGYGVGDTVAGVQHIPVVRPD 488
           + + DGV  C+ + DGY +G     ++HIP+   D
Sbjct: 175 IDSGDGVTHCIPVADGYVIGSC---IKHIPIAGRD 206


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score = 84.6 bits (200), Expect = 6e-17
 Identities = 41/104 (39%), Positives = 63/104 (60%)
 Frame = +3

Query: 198 GTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 377
           GT +++  R  T  + +      ++ G++ +W+  EKI  H++ N L   P EHPVL +E
Sbjct: 77  GTTKIIVPRARTNMESF------MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSE 130

Query: 378 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +  N +A REK+T+IMFE F  PA Y++   VLS +A GRT G+
Sbjct: 131 SSWNDRARREKLTEIMFEKFQVPAYYLSKNVVLSCFAQGRTHGL 174



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 16/54 (29%), Positives = 34/54 (62%)
 Frame = +2

Query: 500 HRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           H  ++DSG   +  VP+++GYA+ HA+++  + G  +T+ L ++L ++    +P
Sbjct: 172 HGLMVDSGATQTSVVPVFDGYAVTHAVVKCPIGGDLITEQLAQMLDQQKIDVIP 225



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 162
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +3

Query: 162 RKAPPSGCDGRHGTERLVRRRRGTEQKRYPDLKY--PIEHGIVTNWDDMEKIWHHTFYNE 335
           R  P S    +H  +R+       E      L Y  PIE G V NWD  ++IW  TF   
Sbjct: 26  RLVPNSIVKAKHEKKRVFVAHEQEECSDKFSLFYVRPIERGYVVNWDTQQQIWEKTF-GS 84

Query: 336 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           + V      + LT+      A  +  ++I+F+ F
Sbjct: 85  MDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +3

Query: 162 RKAPPSGCDGRHGTERLVRRRRGTEQKRYPDLKY--PIEHGIVTNWDDMEKIWHHTFYNE 335
           R  P S    +H  +R+       E      L Y  PIE G V NWD  ++IW  TF   
Sbjct: 26  RLVPNSIVKAKHEKKRVFVAHEQEECSDKFSLFYVRPIERGYVVNWDTQQQIWEKTF-GS 84

Query: 336 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           + V      + LT+      A  +  ++I+F+ F
Sbjct: 85  MDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
           protein T19D12.1 protein.
          Length = 1844

 Score = 33.1 bits (72), Expect = 0.18
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = -3

Query: 245 PLLLCASSPTYESFCPMPTITP*WRGLPTIEGN-TARGASSPAKPALHIPEPLSTTNAAT 69
           PL++ +SS    S     TITP  +G+PT   N      S+P  P   +    STT A +
Sbjct: 464 PLVVSSSSSGSSSTVVTSTITPSTQGVPTSTSNQPTPSTSNPTTPKSTVTASPSTTGATS 523

Query: 68  SSS 60
           ++S
Sbjct: 524 TAS 526


>AL132860-21|CAB60518.2|  759|Caenorhabditis elegans Hypothetical
           protein Y56A3A.27 protein.
          Length = 759

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = -1

Query: 637 GEDLHEVVCEVATGQVQTQDGVREC--VSLVDGYGVGDTVAGVQHIPVVRPDAY 482
           GE   +   ++  G+ Q  D + E   +SL+D YG+G      +HI  ++   Y
Sbjct: 470 GERFTDFELKIGDGKTQAPDFLTEADLISLMDKYGIGTDATHAEHIEKIKTREY 523


>AF057032-1|AAC13567.1|  759|Caenorhabditis elegans DNA
           topoisomerase III protein.
          Length = 759

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = -1

Query: 637 GEDLHEVVCEVATGQVQTQDGVREC--VSLVDGYGVGDTVAGVQHIPVVRPDAY 482
           GE   +   ++  G+ Q  D + E   +SL+D YG+G      +HI  ++   Y
Sbjct: 470 GERFTDFELKIGDGKTQAPDFLTEADLISLMDKYGIGTDATHAEHIEKIKTREY 523


>U10401-4|AAN65289.1|  937|Caenorhabditis elegans Myc and mondo-like
           protein 1, isoformb protein.
          Length = 937

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = -3

Query: 224 SPTYESFCPMPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAAT 69
           SPTY++F    T  P     P+  G+ +  AS P + + H P+ ++  +A++
Sbjct: 670 SPTYQAFAASVTTKPSILESPSTSGDISGPASVPVQASQHPPKIITPPSASS 721


>U10401-3|AAA19059.2| 1009|Caenorhabditis elegans Myc and mondo-like
           protein 1, isoforma protein.
          Length = 1009

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = -3

Query: 224 SPTYESFCPMPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAAT 69
           SPTY++F    T  P     P+  G+ +  AS P + + H P+ ++  +A++
Sbjct: 670 SPTYQAFAASVTTKPSILESPSTSGDISGPASVPVQASQHPPKIITPPSASS 721


>AF264757-1|AAK20949.1| 1009|Caenorhabditis elegans Mlx interactor
           protein.
          Length = 1009

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = -3

Query: 224 SPTYESFCPMPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAAT 69
           SPTY++F    T  P     P+  G+ +  AS P + + H P+ ++  +A++
Sbjct: 670 SPTYQAFAASVTTKPSILESPSTSGDISGPASVPVQASQHPPKIITPPSASS 721


>AF213473-1|AAL50027.1|  913|Caenorhabditis elegans basic
           helix-loop-helix leucinezipper WBSCR14-like protein
           protein.
          Length = 913

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = -3

Query: 224 SPTYESFCPMPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAAT 69
           SPTY++F    T  P     P+  G+ +  AS P + + H P+ ++  +A++
Sbjct: 574 SPTYQAFAASVTTKPSILESPSTSGDISGPASVPVQASQHPPKIITPPSASS 625


>Z27078-8|CAH04706.2| 1446|Caenorhabditis elegans Hypothetical
           protein K04H4.2c protein.
          Length = 1446

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = +1

Query: 316 IIPSTMSSVSPPRNIPSFSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTR 489
           I+P  MSS+SP  + PS +                 C   +T   C+  S P + CTR
Sbjct: 155 IVPKRMSSLSPSTSSPSNTENPCSKCPLGSACRNGNCIPLTTSNLCSDGSPPNNTCTR 212


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +1

Query: 7   RIYVLVTYLIILY*FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 183
           R YV ++ LI  + F +      AL   N     KA + G D P+A F  I+G   ++G
Sbjct: 16  RKYVTLSLLIYNFYFNL------ALGTINCFHFIKASYLGHDTPQATFREIIGNKEYRG 68


>U42848-3|AAA83609.1|  693|Caenorhabditis elegans Hypothetical
           protein C31H1.1 protein.
          Length = 693

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +1

Query: 214 YVGDEAQSKRGILTSNTPSNTESSLTGMTWRRFGIIPSTMSSVSPPRNIPS 366
           Y+GD++  +   L S +  +  SS  G  W+R     S  S+ S P  I S
Sbjct: 99  YLGDKSGFESRTLPSESIMSANSSSLGSHWKRIDSFTSGKSTQSIPTTISS 149


>U80030-2|AAG24161.2|  362|Caenorhabditis elegans Serpentine
           receptor, class w protein121 protein.
          Length = 362

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -1

Query: 493 PDAYSESTAWMATYMAGVLNVSNMIWVIFSLL 398
           P   S  TAW+     GV N+ N +  IFS+L
Sbjct: 286 PYGLSIGTAWIFLLAPGVYNILNQLASIFSML 317


>U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical
           protein F42C5.9 protein.
          Length = 552

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 333 ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           EL+V P ++ VLL+     P     ++ QI  E     +  +  Q  L LYA   TTG+
Sbjct: 266 ELKVEPWKYKVLLSIPQNIPTVLIGELLQICLEDIKFQSAGITRQPSLILYAYDVTTGV 324


>AF288812-1|AAG10199.1|  566|Caenorhabditis elegans synembryn
           protein.
          Length = 566

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 10/35 (28%), Positives = 20/35 (57%)
 Frame = -2

Query: 195 ADHHTLMAGPSDDRGEYGARSIISCETGLAHTGAI 91
           +DH + +AG S+++ EY A  ++     +  TG +
Sbjct: 494 SDHGSALAGMSEEQKEYEAMKLVDAMNQMMETGIV 528


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
           beta protein.
          Length = 1418

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 134 ASSPAKPALHIPEPLSTTNAATSS 63
           +SSPA P++  P P +T++ +TSS
Sbjct: 652 SSSPATPSISGPPPCATSSGSTSS 675


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
           beta homolog EGL-8 protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 134 ASSPAKPALHIPEPLSTTNAATSS 63
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
           defective protein 8,isoform a protein.
          Length = 1419

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 134 ASSPAKPALHIPEPLSTTNAATSS 63
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
           defective protein 8,isoform b protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 134 ASSPAKPALHIPEPLSTTNAATSS 63
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF038608-17|AAC25822.2|  425|Caenorhabditis elegans Hypothetical
           protein C09G12.9 protein.
          Length = 425

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 15/51 (29%), Positives = 23/51 (45%)
 Frame = +3

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYPSTRDT 563
           + Q+M   F       A  A  S   +  T     + A+ +PTPYPS++ T
Sbjct: 127 LLQVMAMVFQEKCPVFARSAANSATNASATNPSAGSSASSTPTPYPSSQPT 177


>AC084158-34|AAK68564.1|  566|Caenorhabditis elegans Resistance to
           inhibitors of cholinesteraseprotein 8, isoform a
           protein.
          Length = 566

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 10/35 (28%), Positives = 20/35 (57%)
 Frame = -2

Query: 195 ADHHTLMAGPSDDRGEYGARSIISCETGLAHTGAI 91
           +DH + +AG S+++ EY A  ++     +  TG +
Sbjct: 494 SDHGSALAGMSEEQKEYEAMKLVDAMNQMMETGIV 528


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,827,358
Number of Sequences: 27780
Number of extensions: 401074
Number of successful extensions: 1724
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1535
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1719
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1476380920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).