SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z32681-6|CAA83605.1|  257|Caenorhabditis elegans Hypothetical pr...   129   2e-30
Z81461-8|CAB03839.1|  442|Caenorhabditis elegans Hypothetical pr...    30   1.4  
AC006610-1|AAK85447.4|  360|Caenorhabditis elegans Hypothetical ...    30   1.4  
AL117195-12|CAB60765.1|  425|Caenorhabditis elegans Hypothetical...    30   1.8  
Z71181-7|CAA94900.2|  485|Caenorhabditis elegans Hypothetical pr...    29   4.2  
AL032631-11|CAB63341.1|  975|Caenorhabditis elegans Hypothetical...    28   7.4  
Z69634-5|CAA93456.1|  731|Caenorhabditis elegans Hypothetical pr...    27   9.8  

>Z32681-6|CAA83605.1|  257|Caenorhabditis elegans Hypothetical
           protein F56F3.5 protein.
          Length = 257

 Score =  129 bits (312), Expect = 2e-30
 Identities = 62/84 (73%), Positives = 72/84 (85%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK VDPF+RK+WYD+KAP+MF+ RQVG TL+NRTQGTKIASEGLKGRVFEVSL D
Sbjct: 12  KKGGKKKAVDPFSRKEWYDIKAPNMFNTRQVGKTLINRTQGTKIASEGLKGRVFEVSLGD 71

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           L    ++E  FRKF+LIAE VQG+
Sbjct: 72  L---NNSEADFRKFKLIAEDVQGK 92



 Score =  107 bits (256), Expect = 1e-23
 Identities = 55/104 (52%), Positives = 66/104 (63%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL NFH M +T DKL  +VKKW TLIEAN  VKTTDGY LRVF I FT K     +KT Y
Sbjct: 94  VLTNFHAMSMTHDKLCSIVKKWHTLIEANTAVKTTDGYTLRVFVIAFTKKSVNQVKKTSY 153

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
            + +++R IR +M   I ++VT  D     +   PDSI KDIEK
Sbjct: 154 TKTSKIRKIRSEMIGCIEKEVTGCDLKEVVSKLIPDSIGKDIEK 197


>Z81461-8|CAB03839.1|  442|Caenorhabditis elegans Hypothetical
           protein C04F12.10 protein.
          Length = 442

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/58 (25%), Positives = 28/58 (48%)
 Frame = -2

Query: 419 WLKESLLVKPMQKTRRTYPSVVFTSMLASMRVCHFLTIHLSLSVVRSMPWKLQSTYVL 246
           W  + LL    Q     YP + + +    + V  FL+I+  +  +  +PW L ST+++
Sbjct: 70  WFNQLLLTA--QLIGGYYPFLWYATASYPLHVAVFLSINSIIETIIDLPWDLYSTFII 125


>AC006610-1|AAK85447.4|  360|Caenorhabditis elegans Hypothetical
           protein C30F12.1 protein.
          Length = 360

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = -1

Query: 573 QALLDVLGNGVRKSTCSPPP*VRVSDVACNDFTHFLSDCSDLSVLGVAR 427
           Q    ++G+  +  +  PPP   ++ V CNDF    S C D+S   ++R
Sbjct: 50  QGNAQIIGSSGQVLSTGPPP--GLAPVQCNDFDSCYSSCDDISHPSLSR 96


>AL117195-12|CAB60765.1|  425|Caenorhabditis elegans Hypothetical
           protein Y57A10A.19 protein.
          Length = 425

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = -1

Query: 690 LHRLRRESSQSTSRSPKTGPSSTLSLSDAKHRAEGK 583
           LHR  ++  +S+S S  +  SS  S  D KHR + K
Sbjct: 179 LHRKSKKKQESSSSSSSSSSSSESSSEDEKHRKDRK 214


>Z71181-7|CAA94900.2|  485|Caenorhabditis elegans Hypothetical
           protein K07C5.7 protein.
          Length = 485

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = -2

Query: 569 PFSMSLAMESGNQLVHHLPESELVTSRVMIS 477
           PF   +   S NQ+V+H+P S   TS+V ++
Sbjct: 125 PFKTLIKNASPNQIVNHVPGSGFYTSKVQLA 155


>AL032631-11|CAB63341.1|  975|Caenorhabditis elegans Hypothetical
           protein Y106G6H.12 protein.
          Length = 975

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +1

Query: 220 IQINRRICARTYVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDV 351
           I++N++ C  +Y+   F   D     + W+V ++  +IEAN DV
Sbjct: 48  IELNKQ-CEESYIKLEFTSHDAHRH-MGWVVNQFNKMIEANKDV 89


>Z69634-5|CAA93456.1|  731|Caenorhabditis elegans Hypothetical
           protein B0001.7 protein.
          Length = 731

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +2

Query: 146 LKGRVFEVSLADLQADTDAERSFRKFRLIAEYVQGR 253
           L+G  + +S+ D +A TD E S +  R IAE+++ R
Sbjct: 201 LRGCSWIMSVVDGKAQTDGEFSDKDLREIAEFIRER 236


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,908,792
Number of Sequences: 27780
Number of extensions: 370274
Number of successful extensions: 1159
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1077
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1158
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1613473434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).