SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U00035-6|AAA50647.1|  315|Caenorhabditis elegans Hypothetical pr...    29   2.3  
AM231686-1|CAJ77755.1|  315|Caenorhabditis elegans GDP-4-keto-6-...    29   2.3  
AL132948-1|CAC51077.1|  735|Caenorhabditis elegans Hypothetical ...    29   2.3  
AF077542-4|AAU20829.1|  315|Caenorhabditis elegans Serpentine re...    29   2.3  
AF016433-6|AAB65391.1|  335|Caenorhabditis elegans Seven tm rece...    28   5.4  

>U00035-6|AAA50647.1|  315|Caenorhabditis elegans Hypothetical
           protein R01H2.5 protein.
          Length = 315

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -3

Query: 505 LSEQCA*TTALKPLCLLGGVFHNTDRSISFMQRVVALHDITVASLVLALQVPSVRVFDFV 326
           L E    T  +    ++GG+FHN   ++ F ++ +A++D      VLAL       FD V
Sbjct: 51  LFESVKPTHVIHLAAMVGGLFHNLAHNLQFFRKNMAIND-----NVLAL----CHEFD-V 100

Query: 325 FKCIFGMSIIIF 290
            KC+  +S  IF
Sbjct: 101 IKCVSCLSTCIF 112


>AM231686-1|CAJ77755.1|  315|Caenorhabditis elegans
           GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4- reductase
           protein.
          Length = 315

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -3

Query: 505 LSEQCA*TTALKPLCLLGGVFHNTDRSISFMQRVVALHDITVASLVLALQVPSVRVFDFV 326
           L E    T  +    ++GG+FHN   ++ F ++ +A++D      VLAL       FD V
Sbjct: 51  LFESVKPTHVIHLAAMVGGLFHNLAHNLQFFRKNMAIND-----NVLAL----CHEFD-V 100

Query: 325 FKCIFGMSIIIF 290
            KC+  +S  IF
Sbjct: 101 IKCVSCLSTCIF 112


>AL132948-1|CAC51077.1|  735|Caenorhabditis elegans Hypothetical
           protein Y39B6A.1 protein.
          Length = 735

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 13/38 (34%), Positives = 16/38 (42%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHH 251
           H   H HG+ G+ +H      HHG    H      HHH
Sbjct: 498 HSPAH-HGHHGEHHHAPAHHGHHGEHGTHHGHHGEHHH 534



 Score = 28.3 bits (60), Expect = 4.1
 Identities = 14/41 (34%), Positives = 17/41 (41%)
 Frame = +3

Query: 126 SIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHH 248
           S+  H    GHG    ++H      HHGA   H A    HH
Sbjct: 663 SLAHHGHHGGHGTHHGAHHSPAHHGHHGAHHEHGAHHGAHH 703



 Score = 27.9 bits (59), Expect = 5.4
 Identities = 14/38 (36%), Positives = 18/38 (47%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHH 251
           H  +HGHG+   ++H      HH AP  H      HHH
Sbjct: 441 HHESHGHGHHSPAHH-GHHGEHHHAPAHHGHHG-EHHH 476



 Score = 27.5 bits (58), Expect = 7.1
 Identities = 15/38 (39%), Positives = 15/38 (39%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHH 251
           H V H H  E    H  P  AHHG    H      HHH
Sbjct: 399 HGVHHRHHGEHHGTHHSP--AHHGEHGTHHGHHGEHHH 434



 Score = 27.1 bits (57), Expect = 9.4
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVH-HHET 257
           H   H HG+ G+ +H     AHHG    H +  + H HHE+
Sbjct: 556 HSPAH-HGHHGEHHH---APAHHGHHGHHGSHGVHHGHHES 592


>AF077542-4|AAU20829.1|  315|Caenorhabditis elegans Serpentine
           receptor, class z protein63 protein.
          Length = 315

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -2

Query: 194 YWYNMVGLTFIPMTMSHIV 138
           Y+Y MV +TFIP  ++HI+
Sbjct: 52  YFYKMVKITFIPSLLTHII 70


>AF016433-6|AAB65391.1|  335|Caenorhabditis elegans Seven tm
           receptor protein 131 protein.
          Length = 335

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = -3

Query: 355 VPSVRVFDFVFKCIFGMSIIIFILRLVSMMYWR 257
           + +V +F F+F C+FG S  + I  L +  ++R
Sbjct: 80  IRNVPIFGFLFTCLFGSSFGLCISLLSTQFFYR 112


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,648,649
Number of Sequences: 27780
Number of extensions: 260800
Number of successful extensions: 829
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 771
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 825
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1176726318
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).