SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical...   176   2e-44
AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical ...   176   2e-44
Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein ( C.ele...   152   2e-37
U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation fact...   152   2e-37
U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical p...   122   4e-28
AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved ger...    84   9e-17
AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical ...    75   4e-14
AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical ...    75   4e-14
Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical pr...    61   1e-09
Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical pr...    61   1e-09
Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical pr...    61   1e-09
Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical pr...    60   2e-09
AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical ...    59   3e-09
AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical ...    59   3e-09
Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical pr...    58   5e-09
Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical pr...    58   5e-09
U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical pr...    58   9e-09
AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical...    56   3e-08
U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA he...    56   4e-08
AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical ...    55   5e-08
AC024753-1|AAF60456.1|  732|Caenorhabditis elegans Hypothetical ...    55   6e-08
AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and bel...    54   1e-07
AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and bel...    54   1e-07
AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and bel...    54   1e-07
Z54327-7|CAD57690.1|  268|Caenorhabditis elegans Hypothetical pr...    53   2e-07
AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical ...    53   2e-07
Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical pr...    53   3e-07
EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.     53   3e-07
CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical ...    53   3e-07
AC024830-10|AAF59610.3|  728|Caenorhabditis elegans Hypothetical...    53   3e-07
AF067608-1|AAC17654.2|  544|Caenorhabditis elegans Hypothetical ...    47   1e-05
AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical ...    46   3e-05
U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical pr...    44   2e-04
U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical pr...    44   2e-04
AF025451-4|AAL16306.1|  567|Caenorhabditis elegans Hypothetical ...    43   2e-04
AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical ...    43   2e-04
Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical pr...    43   3e-04
Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical pr...    42   5e-04
AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical...    41   8e-04
U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase pr...    40   0.001
L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase pr...    40   0.001
AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line hel...    40   0.001
AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA ...    37   0.014
AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line hel...    37   0.014
AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA ...    37   0.018
AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line hel...    37   0.018
U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.        36   0.024
U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GL...    36   0.024
AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line he...    36   0.024
AL132948-1|CAC51077.1|  735|Caenorhabditis elegans Hypothetical ...    33   0.17 
U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical pr...    28   6.3  
L15201-3|AAA27944.1|  262|Caenorhabditis elegans Hypothetical pr...    28   8.4  
AL032637-15|CAA21616.2|  370|Caenorhabditis elegans Hypothetical...    28   8.4  
AF039039-1|AAB94180.2|  653|Caenorhabditis elegans Hypothetical ...    28   8.4  

>AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical
           protein F33D11.10 protein.
          Length = 399

 Score =  176 bits (428), Expect = 2e-44
 Identities = 101/208 (48%), Positives = 131/208 (62%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +DT +RE QALIL+PTRELA QIQKVV+ALGD++N +CHACIGGTN+
Sbjct: 75  GKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNL 134

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI            L L +  +   +  + +     R
Sbjct: 135 GEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYR 194

Query: 361 F----CQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTCIELEE 525
           +     Q++  S       L M  K++     I    L +R  L  + +   F  ++ EE
Sbjct: 195 YLPPGAQVVLLSATLPHEILEMTSKFMTDPIRI----LVKRDELTLEGIKQFFVAVDREE 250

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WK +TL DLYDTL+I QAV+FCNTRRKV
Sbjct: 251 WKFDTLIDLYDTLTITQAVLFCNTRRKV 278



 Score =  114 bits (275), Expect = 6e-26
 Identities = 65/169 (38%), Positives = 100/169 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IKL VLDEADEML++GFK+Q++D+++ L    QV+LLSAT+P ++LE++  F
Sbjct: 161 RRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKF 220

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 221 MTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDW 280

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
             +             GDM+Q++ + +MK        V   +TD+WARG
Sbjct: 281 LTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVL-ISTDVWARG 328



 Score = 31.5 bits (68), Expect = 0.68
 Identities = 12/19 (63%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLT+ M   +FTVS+MHG
Sbjct: 279 DWLTDKMKEANFTVSSMHG 297


>AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical
           protein Y65B4A.6 protein.
          Length = 399

 Score =  176 bits (428), Expect = 2e-44
 Identities = 101/208 (48%), Positives = 131/208 (62%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +DT +RE QALIL+PTRELA QIQKVV+ALGD++N +CHACIGGTN+
Sbjct: 75  GKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNL 134

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI            L L +  +   +  + +     R
Sbjct: 135 GEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYR 194

Query: 361 F----CQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTCIELEE 525
           +     Q++  S       L M  K++     I    L +R  L  + +   F  ++ EE
Sbjct: 195 YLPPGAQVVLLSATLPHEILEMTSKFMTDPIRI----LVKRDELTLEGIKQFFVAVDREE 250

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WK +TL DLYDTL+I QAV+FCNTRRKV
Sbjct: 251 WKFDTLIDLYDTLTITQAVLFCNTRRKV 278



 Score =  114 bits (275), Expect = 6e-26
 Identities = 65/169 (38%), Positives = 100/169 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IKL VLDEADEML++GFK+Q++D+++ L    QV+LLSAT+P ++LE++  F
Sbjct: 161 RRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKF 220

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 221 MTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDW 280

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
             +             GDM+Q++ + +MK        V   +TD+WARG
Sbjct: 281 LTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVL-ISTDVWARG 328



 Score = 31.5 bits (68), Expect = 0.68
 Identities = 12/19 (63%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLT+ M   +FTVS+MHG
Sbjct: 279 DWLTDKMKEANFTVSSMHG 297


>Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein (
           C.elegans mRNA for eIF-4A homologue. ).
          Length = 402

 Score =  152 bits (369), Expect = 2e-37
 Identities = 90/207 (43%), Positives = 125/207 (60%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFS+SILQ+ID      QAL++APTRELAQQIQKV+ ALG++LN     CIGGT+V
Sbjct: 78  GKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSV 137

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           R+D R+LE+G+HVVVGTPGRV DMI         ++ + +  L +    +SR        
Sbjct: 138 RDDQRKLEAGIHVVVGTPGRVGDMI---NRNALDTSRIKMFVLDEADEMLSRGFKDQIYE 194

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEEW 528
             + M +    +L    M  + LD     +      L ++  L  + +  F   ++ +EW
Sbjct: 195 VFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEW 254

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           K + LCDLY+ +++ QAVIFCNTRRKV
Sbjct: 255 KFDCLCDLYNVVNVTQAVIFCNTRRKV 281



 Score =  131 bits (317), Expect = 5e-31
 Identities = 78/170 (45%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL  + IK+FVLDEADEMLSRGFKDQI++VF+ +  DVQV+LLSATMP +VL+V+  F
Sbjct: 164 RNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRF 223

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MR+P+RILV+K+ELTLEGI+QFY++ +++ E         Y V   +   +   ++  + 
Sbjct: 224 MRNPIRILVKKDELTLEGIRQFYIN-VQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVD 282

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
           +L   +      + C+ GDMDQ E + IM+        V   TTD+ ARG
Sbjct: 283 TLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVL-ITTDILARG 331


>U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation factor
           protein 1, isoforma protein.
          Length = 402

 Score =  152 bits (369), Expect = 2e-37
 Identities = 90/207 (43%), Positives = 125/207 (60%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFS+SILQ+ID      QAL++APTRELAQQIQKV+ ALG++LN     CIGGT+V
Sbjct: 78  GKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSV 137

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           R+D R+LE+G+HVVVGTPGRV DMI         ++ + +  L +    +SR        
Sbjct: 138 RDDQRKLEAGIHVVVGTPGRVGDMI---NRNALDTSRIKMFVLDEADEMLSRGFKDQIYE 194

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEEW 528
             + M +    +L    M  + LD     +      L ++  L  + +  F   ++ +EW
Sbjct: 195 VFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEW 254

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           K + LCDLY+ +++ QAVIFCNTRRKV
Sbjct: 255 KFDCLCDLYNVVNVTQAVIFCNTRRKV 281



 Score =  131 bits (317), Expect = 5e-31
 Identities = 78/170 (45%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL  + IK+FVLDEADEMLSRGFKDQI++VF+ +  DVQV+LLSATMP +VL+V+  F
Sbjct: 164 RNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRF 223

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MR+P+RILV+K+ELTLEGI+QFY++ +++ E         Y V   +   +   ++  + 
Sbjct: 224 MRNPIRILVKKDELTLEGIRQFYIN-VQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVD 282

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
           +L   +      + C+ GDMDQ E + IM+        V   TTD+ ARG
Sbjct: 283 TLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVL-ITTDILARG 331


>U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical
           protein F57B9.3 protein.
          Length = 363

 Score =  122 bits (293), Expect = 4e-28
 Identities = 55/77 (71%), Positives = 71/77 (92%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           IK+FVLDEADEMLS+GFKDQI++VF+ +  DVQV+LLSATMP +VL+V+  FMRDP+RIL
Sbjct: 131 IKMFVLDEADEMLSKGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRDPIRIL 190

Query: 462 VQKEELTLEGIKQFYMH 512
           V+K+ELTLEGI+QFY++
Sbjct: 191 VKKDELTLEGIRQFYIN 207



 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 58/207 (28%), Positives = 93/207 (44%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT    I ILQ ID      Q ++LAP R +AQ+  + + +LG +LN     C+G    
Sbjct: 45  GKTVISLIDILQGIDCEDAHLQVILLAPQRGMAQRAHEQLKSLGRNLNVNA-TCLGFDTT 103

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            E+    +   HV++GTP      I      P+ ++ + +  L +    +S+        
Sbjct: 104 AEN----DKISHVLMGTPKDFLSNI------PSDTSRIKMFVLDEADEMLSKGFKDQIYE 153

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEEW 528
             + M +    +L    M  + LD     +      L ++  L  + +  F   ++ +EW
Sbjct: 154 VFRSMPQDVQVVLLSATMPSEVLDVTNRFMRDPIRILVKKDELTLEGIRQFYINVQKDEW 213

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           K   LCDL  T    QA+IFCNTRR+V
Sbjct: 214 KFNCLCDLLKTSRETQALIFCNTRRRV 240


>AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved
           germline helicase protein1 protein.
          Length = 430

 Score = 84.2 bits (199), Expect = 9e-17
 Identities = 54/215 (25%), Positives = 102/215 (47%), Gaps = 10/215 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I ++++I  +++  QA+++ PTRELA Q  ++ + L  H+  K     GGT++
Sbjct: 92  GKTGAYCIPVIEKIQPALKAIQAMVIVPTRELALQTSQICVELSKHIQLKVMVTTGGTDL 151

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           R+DI +L   VH+V+ TPGR+ D++              + K+  C   V      + S+
Sbjct: 152 RDDIMRLNGTVHLVIATPGRILDLM-----------EKGVAKMEHCKTLVLDEADKLLSQ 200

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKV----------LNNFTC 510
             Q +     + LP       Y       + +++ +    P+++          +  +  
Sbjct: 201 DFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINLMEELTLLGVTQYYA 260

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
              E+ K+  L  L+  L I Q++IFCN+ ++V L
Sbjct: 261 FVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVEL 295



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 30/74 (40%), Positives = 43/74 (58%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           K  VLDEAD++LS+ F+  +  +   L  + QV+L SAT P+ V    +  M  P  I +
Sbjct: 187 KTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINL 246

Query: 465 QKEELTLEGIKQFY 506
             EELTL G+ Q+Y
Sbjct: 247 M-EELTLLGVTQYY 259


>AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical
           protein H20J04.4a protein.
          Length = 488

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 39/85 (45%), Positives = 50/85 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F+I ILQ++        ALIL PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 138 GKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSL 197

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
               R+L    HVVV TPGR+ D+I
Sbjct: 198 IHQARELSERPHVVVATPGRLADLI 222



 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 2/78 (2%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDP--VR 455
           I+ FVLDEAD ML   + DQ+  +F+ +S   Q +LLSAT+ +++  + R   R P    
Sbjct: 236 IQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFE 295

Query: 456 ILVQKEELTLEGIKQFYM 509
              + +E T++ ++Q Y+
Sbjct: 296 DKGKDDESTVDRLEQKYV 313


>AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical
           protein H20J04.4b protein.
          Length = 561

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 39/85 (45%), Positives = 50/85 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F+I ILQ++        ALIL PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 138 GKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSL 197

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
               R+L    HVVV TPGR+ D+I
Sbjct: 198 IHQARELSERPHVVVATPGRLADLI 222



 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 2/78 (2%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDP--VR 455
           I+ FVLDEAD ML   + DQ+  +F+ +S   Q +LLSAT+ +++  + R   R P    
Sbjct: 236 IQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFE 295

Query: 456 ILVQKEELTLEGIKQFYM 509
              + +E T++ ++Q Y+
Sbjct: 296 DKGKDDESTVDRLEQKYV 313


>Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical
           protein T07D4.4c protein.
          Length = 613

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 59/214 (27%), Positives = 99/214 (46%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N
Sbjct: 260 GKTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGN 319

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFM-PTPSNFLFL-----MKLMKCCPEVSRT 339
           +   +R  +    +V+GTPG   D +   + + P+    L L     M   +   ++S T
Sbjct: 320 MAA-MRGRKLTEQIVIGTPGITRDYLQKYKCIDPSKIRCLVLDEADVMIYHQGFTDISTT 378

Query: 340 RSMM----SSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFT 507
              M    S     ++F + Y   P +    K +      +   L R +     +   + 
Sbjct: 379 IYNMVEDASDSVQSMLFSATYD-EPVINFATKIIK---NAIVVMLKREEQALPNIKQFYV 434

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
                + K   + +LY  L++A +VIFC+T+  V
Sbjct: 435 QCACRDSKYAAIVNLYSGLAVASSVIFCHTKASV 468



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 4/87 (4%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEML-SRGFKD---QIHDVFKILSADVQVILLSATMPDDVLEVS 428
           + +  + I+  VLDEAD M+  +GF D    I+++ +  S  VQ +L SAT  + V+  +
Sbjct: 348 KCIDPSKIRCLVLDEADVMIYHQGFTDISTTIYNMVEDASDSVQSMLFSATYDEPVINFA 407

Query: 429 RCFMRDPVRILVQKEELTLEGIKQFYM 509
              +++ + +++++EE  L  IKQFY+
Sbjct: 408 TKIIKNAIVVMLKREEQALPNIKQFYV 434


>Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical
           protein T07D4.4b protein.
          Length = 638

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 59/214 (27%), Positives = 99/214 (46%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N
Sbjct: 285 GKTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGN 344

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFM-PTPSNFLFL-----MKLMKCCPEVSRT 339
           +   +R  +    +V+GTPG   D +   + + P+    L L     M   +   ++S T
Sbjct: 345 MAA-MRGRKLTEQIVIGTPGITRDYLQKYKCIDPSKIRCLVLDEADVMIYHQGFTDISTT 403

Query: 340 RSMM----SSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFT 507
              M    S     ++F + Y   P +    K +      +   L R +     +   + 
Sbjct: 404 IYNMVEDASDSVQSMLFSATYD-EPVINFATKIIK---NAIVVMLKREEQALPNIKQFYV 459

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
                + K   + +LY  L++A +VIFC+T+  V
Sbjct: 460 QCACRDSKYAAIVNLYSGLAVASSVIFCHTKASV 493



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 4/87 (4%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEML-SRGFKD---QIHDVFKILSADVQVILLSATMPDDVLEVS 428
           + +  + I+  VLDEAD M+  +GF D    I+++ +  S  VQ +L SAT  + V+  +
Sbjct: 373 KCIDPSKIRCLVLDEADVMIYHQGFTDISTTIYNMVEDASDSVQSMLFSATYDEPVINFA 432

Query: 429 RCFMRDPVRILVQKEELTLEGIKQFYM 509
              +++ + +++++EE  L  IKQFY+
Sbjct: 433 TKIIKNAIVVMLKREEQALPNIKQFYV 459


>Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical protein
            T07D4.4a protein.
          Length = 1022

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 59/214 (27%), Positives = 99/214 (46%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1    GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
            GKTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N
Sbjct: 669  GKTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGN 728

Query: 178  VREDIRQLESGVHVVVGTPGRVYDMILVVRFM-PTPSNFLFL-----MKLMKCCPEVSRT 339
            +   +R  +    +V+GTPG   D +   + + P+    L L     M   +   ++S T
Sbjct: 729  MAA-MRGRKLTEQIVIGTPGITRDYLQKYKCIDPSKIRCLVLDEADVMIYHQGFTDISTT 787

Query: 340  RSMM----SSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFT 507
               M    S     ++F + Y   P +    K +      +   L R +     +   + 
Sbjct: 788  IYNMVEDASDSVQSMLFSATYD-EPVINFATKIIK---NAIVVMLKREEQALPNIKQFYV 843

Query: 508  CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
                 + K   + +LY  L++A +VIFC+T+  V
Sbjct: 844  QCACRDSKYAAIVNLYSGLAVASSVIFCHTKASV 877



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 4/87 (4%)
 Frame = +3

Query: 261  RALHANTIKLFVLDEADEML-SRGFKD---QIHDVFKILSADVQVILLSATMPDDVLEVS 428
            + +  + I+  VLDEAD M+  +GF D    I+++ +  S  VQ +L SAT  + V+  +
Sbjct: 757  KCIDPSKIRCLVLDEADVMIYHQGFTDISTTIYNMVEDASDSVQSMLFSATYDEPVINFA 816

Query: 429  RCFMRDPVRILVQKEELTLEGIKQFYM 509
               +++ + +++++EE  L  IKQFY+
Sbjct: 817  TKIIKNAIVVMLKREEQALPNIKQFYV 843


>Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical
           protein C26D10.2a protein.
          Length = 425

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 29/83 (34%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L  + +K FVLDE D+M+     +  + ++ K+     QV++ SAT+P ++  V + FM+
Sbjct: 181 LKLDKVKYFVLDECDKMIGDADMRRDVQEIVKMTPQQKQVMMFSATLPKELRTVCKRFMQ 240

Query: 444 DPVRILVQKE-ELTLEGIKQFYM 509
           DP+ + V  E +LTL G++Q Y+
Sbjct: 241 DPMEVYVDDEAKLTLHGLQQHYV 263



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F I+ LQQ++    E   + +  TRELA QI K       +L   K     GG  
Sbjct: 90  GKTAVFVITTLQQLEPVDGEVSVVCMCHTRELAFQISKEYERFSKYLPGVKVAVFFGGMA 149

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D  +L +   H+VVGTPGR+
Sbjct: 150 IKKDEERLANDCPHIVVGTPGRM 172


>AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5a protein.
          Length = 825

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT-SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA F I +LQ++        +AL+++PTRELA Q  KVV  LG     +C   +GG  
Sbjct: 73  GKTAAFVIPMLQKLKRRDTTGIRALMVSPTRELALQTFKVVKELGRFTGLRCACLVGGDQ 132

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMIL 258
           + E    +     +++ TPGR+  +I+
Sbjct: 133 IEEQFSTIHENPDILLATPGRLLHVIV 159



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 20/70 (28%), Positives = 40/70 (57%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + ++  V DEAD +   GF+DQ+ +  K +    Q +L SAT+P  +++ ++  + D
Sbjct: 163 LRLSYVQYVVFDEADRLFEMGFQDQLTETLKRIPESRQTLLFSATLPKMLVDFAKAGLTD 222

Query: 447 PVRILVQKEE 476
           P+ + +  +E
Sbjct: 223 PMLVRLDVDE 232


>AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5b protein.
          Length = 871

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT-SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA F I +LQ++        +AL+++PTRELA Q  KVV  LG     +C   +GG  
Sbjct: 73  GKTAAFVIPMLQKLKRRDTTGIRALMVSPTRELALQTFKVVKELGRFTGLRCACLVGGDQ 132

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMIL 258
           + E    +     +++ TPGR+  +I+
Sbjct: 133 IEEQFSTIHENPDILLATPGRLLHVIV 159



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 20/70 (28%), Positives = 40/70 (57%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + ++  V DEAD +   GF+DQ+ +  K +    Q +L SAT+P  +++ ++  + D
Sbjct: 163 LRLSYVQYVVFDEADRLFEMGFQDQLTETLKRIPESRQTLLFSATLPKMLVDFAKAGLTD 222

Query: 447 PVRILVQKEE 476
           P+ + +  +E
Sbjct: 223 PMLVRLDVDE 232


>Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical
           protein F58E10.3a protein.
          Length = 561

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 35/90 (38%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQA-----LILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F +  L  I       +      L+L PTRELAQQ+Q+V I     L  K     
Sbjct: 178 GKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLF 237

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG +     R LE GV +VV TPGR+ D +
Sbjct: 238 GGASKGPQARDLERGVDIVVATPGRLLDFL 267



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 24/62 (38%), Positives = 34/62 (54%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V  ++  F +D   + V   
Sbjct: 281 VLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSL 340

Query: 474 EL 479
           EL
Sbjct: 341 EL 342


>Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical
           protein T26G10.1 protein.
          Length = 489

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 24/86 (27%), Positives = 48/86 (55%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  ++DEAD +L+  F+ ++  + K++  + +  L SATM   V ++ R
Sbjct: 178 ENTKGFNLKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMTKKVSKLER 237

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +RDP R+ V     T++ +KQ Y+
Sbjct: 238 ASLRDPARVSVSSRYKTVDNLKQHYI 263



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 30/83 (36%), Positives = 43/83 (51%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F+I +LQ +    +    L+L PTRELA QI +   ALG  +       +GG ++
Sbjct: 93  GKTGAFAIPVLQSLLDHPQAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDM 152

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H++V TPGR+ D
Sbjct: 153 AAQAMALARRPHIIVATPGRLVD 175


>U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical
           protein F01F1.7 protein.
          Length = 730

 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 37/95 (38%), Positives = 54/95 (56%), Gaps = 10/95 (10%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ----------ALILAPTRELAQQIQKVVIALGDHLNAK 150
           GKTA F + +L  I TS+ + +          A+I+APTRELAQQI++     G  L  K
Sbjct: 350 GKTAAFLLPLLVWI-TSLPKMERQEHRDLGPYAIIMAPTRELAQQIEEETNKFGKLLGIK 408

Query: 151 CHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
             + IGG +  +   +L  GV VV+ TPGR+ D++
Sbjct: 409 TVSVIGGASREDQGMKLRMGVEVVIATPGRLLDVL 443



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL 365
           R L  N     +LDEAD ML  GF+  +  V + +
Sbjct: 446 RYLLLNQCTYVILDEADRMLDMGFEPDVQKVLEYM 480


>AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical
           protein Y71G12B.8 protein.
          Length = 763

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 24/86 (27%), Positives = 53/86 (61%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           ++R+       ++ VLDEAD ML   F+DQ++++ ++ + + Q +L SATM +++ E++ 
Sbjct: 309 NSRKICKIPNFQVLVLDEADRMLEEAFRDQMNELIRLCAQNRQTLLFSATMTEEIDELAS 368

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             ++ PV+I + +   T   ++Q ++
Sbjct: 369 MSLQKPVKIFINENTDTALKLRQEFI 394



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 33/86 (38%), Positives = 48/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR--EC-QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F + IL+++    +   C + L+L PTRELA Q+ +V   L   +  +   C GG
Sbjct: 197 GKTAAFVLPILERMIYRPKGASCTRVLVLVPTRELAIQVFQVFRKLSTFIQLEVCLCAGG 256

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +++     L SG  VVV TPGR+ D
Sbjct: 257 LDLKAQEAALRSGPDVVVATPGRLID 282


>U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA
           helicase protein.
          Length = 417

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + +K FVLDE D+M+  G  D   DV +I     QV++ SAT+P ++  V + FM+D
Sbjct: 180 LKLDKVKYFVLDECDKMI--GDADMRRDVQEIK----QVMMFSATLPKELRTVCKRFMQD 233

Query: 447 PVRILVQKE-ELTLEGIKQFYM 509
           P+ + V  E +LTL G++Q Y+
Sbjct: 234 PMEVYVDDEAKLTLHGLQQHYV 255



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F I+ LQQ++    E   + +  TRELA QI K       +L   K     GG  
Sbjct: 89  GKTAVFVITTLQQLEPVDGEVSVVCMCHTRELAFQISKEYERFSKYLPGVKVAVFFGGMA 148

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D  +L +   H+VVGTPGR+
Sbjct: 149 IKKDEERLANDCPHIVVGTPGRM 171


>AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical
           protein H27M09.1 protein.
          Length = 630

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 6/68 (8%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNA------KCHACIGGTNVREDIRQLESGVHVVVGT 231
           LI+ P+RELA+QI  ++I + D L        +   CIGG  + E  + +  G+H+VV T
Sbjct: 270 LIIVPSRELARQIFDLIIEMFDALGKAGLPEMRAGLCIGGVPIGEQAKDVRDGIHIVVAT 329

Query: 232 PGRVYDMI 255
           PGR+ DM+
Sbjct: 330 PGRLSDML 337



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           T++ ++    +  VLDEAD ML  GF+D+I  +F    A  Q +L SATMP  +   ++ 
Sbjct: 338 TKKIINLEVCRYLVLDEADRMLDMGFEDEIKSIFYFFKAQRQTLLFSATMPRKIQFFAKS 397

Query: 435 FMRDPVRILV 464
            +  P+ + V
Sbjct: 398 ALVKPIVVNV 407


>AC024753-1|AAF60456.1|  732|Caenorhabditis elegans Hypothetical
           protein Y23H5B.6 protein.
          Length = 732

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 29/88 (32%), Positives = 48/88 (54%), Gaps = 2/88 (2%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D    +  +++++ VLDEAD ML  GF  Q++ +   L A+ Q +L SAT   +V ++ R
Sbjct: 213 DENAQMSCDSLQVLVLDEADRMLDMGFSKQLNSIINNLPAERQTLLFSATQTRNVKDLCR 272

Query: 432 CFMRDPVRILVQK--EELTLEGIKQFYM 509
               DPV + V +     T + +KQ Y+
Sbjct: 273 VCTNDPVFVSVHENASAATPDNLKQSYV 300



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 26/59 (44%), Positives = 38/59 (64%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           ALI++PTRELA Q    + A+G H    C   IGG++V  + R   SG++++V TPGR+
Sbjct: 151 ALIISPTRELALQTFSTINAVGAHHGFSCGLVIGGSDVAFE-RNRISGINIIVCTPGRL 208


>AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform c protein.
          Length = 660

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT-NVREDIRQLESGVHVVVGTPGRV 243
           AL+L+PTRELA QI K         N +     GG  N R+ + +L +G H+++ TPGR+
Sbjct: 225 ALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRL 284

Query: 244 YDMI 255
            D+I
Sbjct: 285 IDII 288



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVF---KILSADVQVILLSATMPDDVLEVSRCFMRDP-V 452
           +  VLDEAD ML  GF+ QI  +              + SAT P ++  +++ F++D  +
Sbjct: 299 RYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYI 358

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I+Q
Sbjct: 359 FLAVGRVGSTSENIEQ 374


>AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform b protein.
          Length = 644

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT-NVREDIRQLESGVHVVVGTPGRV 243
           AL+L+PTRELA QI K         N +     GG  N R+ + +L +G H+++ TPGR+
Sbjct: 209 ALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRL 268

Query: 244 YDMI 255
            D+I
Sbjct: 269 IDII 272



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVF---KILSADVQVILLSATMPDDVLEVSRCFMRDP-V 452
           +  VLDEAD ML  GF+ QI  +              + SAT P ++  +++ F++D  +
Sbjct: 283 RYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYI 342

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I+Q
Sbjct: 343 FLAVGRVGSTSENIEQ 358


>AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform a protein.
          Length = 641

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT-NVREDIRQLESGVHVVVGTPGRV 243
           AL+L+PTRELA QI K         N +     GG  N R+ + +L +G H+++ TPGR+
Sbjct: 206 ALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRL 265

Query: 244 YDMI 255
            D+I
Sbjct: 266 IDII 269



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVF---KILSADVQVILLSATMPDDVLEVSRCFMRDP-V 452
           +  VLDEAD ML  GF+ QI  +              + SAT P ++  +++ F++D  +
Sbjct: 280 RYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYI 339

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I+Q
Sbjct: 340 FLAVGRVGSTSENIEQ 355


>Z54327-7|CAD57690.1|  268|Caenorhabditis elegans Hypothetical
           protein C26D10.2b protein.
          Length = 268

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F I+ LQQ++    E   + +  TRELA QI K       +L   K     GG  
Sbjct: 90  GKTAVFVITTLQQLEPVDGEVSVVCMCHTRELAFQISKEYERFSKYLPGVKVAVFFGGMA 149

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D  +L +   H+VVGTPGR+
Sbjct: 150 IKKDEERLANDCPHIVVGTPGRM 172



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L  + +K FVLDE D+M+     +  + ++ K+     QV++ SAT+P ++  V + FM+
Sbjct: 181 LKLDKVKYFVLDECDKMIGDADMRRDVQEIVKMTPQQKQVMMFSATLPKELRTVCKRFMQ 240

Query: 444 DPVRILVQKE 473
           D VR +   E
Sbjct: 241 D-VRFISDPE 249


>AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical
           protein F53H1.1 protein.
          Length = 970

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 33/90 (36%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + + + I     + E     A+ILAPTRELA Q  K        L  K     
Sbjct: 353 GKTLAFLLPMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKFAKPLGLKVACTY 412

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG  + E I  L+ G  +VV TPGR+ D++
Sbjct: 413 GGVGISEQIADLKRGAEIVVCTPGRMIDVL 442



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 29/95 (30%), Positives = 45/95 (47%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  ++ +  +   +   VLDEAD M  +GF+ QI  V   +  D Q +L S
Sbjct: 433 CTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIRPDKQTVLFS 492

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  +  PV ILV  + +    I Q
Sbjct: 493 ATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQ 527


>Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical
           protein ZK512.2 protein.
          Length = 578

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI---RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKT  F + +++ I  +     +  ALIL+P+REL  QI  V+    + LN       GG
Sbjct: 58  GKTLAFVLPMMRMIQNAKLQPADIGALILSPSRELCSQIVSVIQPFAEKLNLTVETVTGG 117

Query: 172 TNVREDIRQLES-GVHVVVGTPGRVYDMI 255
             V ++I+  ++  V+++V TPGR++ +I
Sbjct: 118 QKVDKNIKMFKNKNVNILVATPGRLFQII 146



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATM--PDDVLEVSRCFMRDPV 452
           T++L V+DEAD      F+D + ++   +    +  L SAT    +D L V        V
Sbjct: 159 TLQLLVIDEADRFNEIQFEDHMREILSCIPKQRRTGLFSATQVKEEDDLMVFGLRNAKQV 218

Query: 453 RILVQKEELTLEGIKQFYM 509
           ++  ++       +K +Y+
Sbjct: 219 KVAQERNSAAPSTLKNYYV 237


>EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.
          Length = 973

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 26/80 (32%), Positives = 46/80 (57%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           A++ + +  FVLDEAD+++   F+D I+ +   L    QV + SAT P ++  +   F+R
Sbjct: 159 AMNMSHVDFFVLDEADKLMDEVFRDDINIIINSLPQIRQVAVFSATYPRNLDNLLSTFLR 218

Query: 444 DPVRILVQKEELTLEGIKQF 503
           D   +    +++ L GIKQ+
Sbjct: 219 DAALVRFNADDVQLFGIKQY 238



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 31/113 (27%), Positives = 60/113 (53%), Gaps = 1/113 (0%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  FS+  ++ +D+     Q +I+ PTRE++ QI++ V  +     A+    +GG+  
Sbjct: 71  GKTLVFSVLAVENLDSRSSHIQKVIVTPTREISVQIKETVRKVAP-TGARTSVYVGGSAH 129

Query: 181 REDIRQL-ESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR 336
           + ++  L ++   +V+GTPGR+  ++ +     +  +F  L +  K   EV R
Sbjct: 130 KLNLIDLKQTRPQIVIGTPGRIAQLVKLGAMNMSHVDFFVLDEADKLMDEVFR 182


>CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical
           protein T06A10.1 protein.
          Length = 973

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 26/80 (32%), Positives = 46/80 (57%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           A++ + +  FVLDEAD+++   F+D I+ +   L    QV + SAT P ++  +   F+R
Sbjct: 159 AMNMSHVDFFVLDEADKLMDEVFRDDINIIINSLPQIRQVAVFSATYPRNLDNLLSTFLR 218

Query: 444 DPVRILVQKEELTLEGIKQF 503
           D   +    +++ L GIKQ+
Sbjct: 219 DAALVRFNADDVQLFGIKQY 238



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 31/113 (27%), Positives = 60/113 (53%), Gaps = 1/113 (0%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  FS+  ++ +D+     Q +I+ PTRE++ QI++ V  +     A+    +GG+  
Sbjct: 71  GKTLVFSVLAVENLDSRSSHIQKVIVTPTREISVQIKETVRKVAP-TGARTSVYVGGSAH 129

Query: 181 REDIRQL-ESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR 336
           + ++  L ++   +V+GTPGR+  ++ +     +  +F  L +  K   EV R
Sbjct: 130 KLNLIDLKQTRPQIVIGTPGRIAQLVKLGAMNMSHVDFFVLDEADKLMDEVFR 182


>AC024830-10|AAF59610.3|  728|Caenorhabditis elegans Hypothetical
           protein Y55F3BR.1 protein.
          Length = 728

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 3/75 (4%)
 Frame = +1

Query: 40  IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA---KCHACIGGTNVREDIRQLESG 210
           ID+S   C  +IL PTREL QQ  + +      L++   +C     G N+ + +R LE+G
Sbjct: 277 IDSSTPLC--VILEPTRELVQQTFQNIQTFASVLDSPKIRCVTLAAGENMNQILRTLETG 334

Query: 211 VHVVVGTPGRVYDMI 255
             +VVGTP RV+D+I
Sbjct: 335 CDIVVGTPSRVFDLI 349


>AF067608-1|AAC17654.2|  544|Caenorhabditis elegans Hypothetical
           protein B0511.6 protein.
          Length = 544

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR-DPVRI 458
           +K  ++DEAD +L  GF+ ++  V + L    Q +L SAT    V E+ +  +  +PVR+
Sbjct: 216 MKCLIIDEADRILDIGFEIEMQQVLRHLPKQRQSMLFSATHSPKVDELVKLALHSNPVRV 275

Query: 459 LVQK--EELTLEGIKQFYM 509
            V +  EE T+EG++Q Y+
Sbjct: 276 SVHEKAEEATVEGLQQGYI 294



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1   GKTATF---SISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F   +I +L +++         +I++PTREL+ Q   V+  L +  N      +G
Sbjct: 117 GKTLAFLLPAIELLHKLNWKQHNGTGVIIVSPTRELSMQTYGVLSELLEGSNLTYGLVMG 176

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD 249
           G+N   +  +L  GV ++V TPGR+ D
Sbjct: 177 GSNRSAEKDKLAKGVSILVATPGRLLD 203


>AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical
           protein Y54G11A.3 protein.
          Length = 504

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 32/96 (33%), Positives = 46/96 (47%), Gaps = 12/96 (12%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ-----------ALILAPTRELAQQIQKVVIALGDHLNA 147
           GKT  F +  L  ID  + + +            L+L+PTRELAQQI+  V       N 
Sbjct: 133 GKTLAFLLPALLHIDAQLAQYEKNDEEQKPSPFVLVLSPTRELAQQIEGEVKKYS--YNG 190

Query: 148 KCHACI-GGTNVREDIRQLESGVHVVVGTPGRVYDM 252
               C+ GG +  E +     GV +V+ TPGR+ D+
Sbjct: 191 YKSVCLYGGGSRPEQVEACRGGVEIVIATPGRLTDL 226



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ++   VLDEAD ML  GF+  I  +   +  D  V L SAT P+ V +++  + ++ V  
Sbjct: 236 SVTYVVLDEADRMLDMGFEVAIRRILFEIRPDRLVALTSATWPEGVRKLTDKYTKEAVMA 295

Query: 459 LVQKEELT-LEGIKQFY 506
           +    +LT  + + QF+
Sbjct: 296 VNGSLDLTSCKSVTQFF 312


>U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical
           protein F55F8.2b protein.
          Length = 579

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 1/110 (0%)
 Frame = +1

Query: 46  TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG-TNVREDIRQLESGVHVV 222
           T +R  +ALI+APTREL  QI K + AL         + +GG   V+++    +    +V
Sbjct: 64  TEVRGPRALIVAPTRELVIQIMKHINALISTTQLIATSIVGGLAQVKQERIISQQRPDIV 123

Query: 223 VGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSRFCQL 372
           V TPGR++ M+           FL   K +KC       R +    F +L
Sbjct: 124 VATPGRLWAMMQEAE----TGEFLAEWKDLKCLVVDETDRMVEEGYFAEL 169


>U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical
           protein F55F8.2a protein.
          Length = 746

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 1/110 (0%)
 Frame = +1

Query: 46  TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG-TNVREDIRQLESGVHVV 222
           T +R  +ALI+APTREL  QI K + AL         + +GG   V+++    +    +V
Sbjct: 231 TEVRGPRALIVAPTRELVIQIMKHINALISTTQLIATSIVGGLAQVKQERIISQQRPDIV 290

Query: 223 VGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSRFCQL 372
           V TPGR++ M+           FL   K +KC       R +    F +L
Sbjct: 291 VATPGRLWAMMQEAE----TGEFLAEWKDLKCLVVDETDRMVEEGYFAEL 336


>AF025451-4|AAL16306.1|  567|Caenorhabditis elegans Hypothetical
           protein C24H12.4b protein.
          Length = 567

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/64 (31%), Positives = 36/64 (56%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R  +   +   V+DEAD +LS G+++++  +   L    Q ++ SAT+ DD+  + + FM
Sbjct: 164 RPEYCTLVSYLVMDEADLLLSFGYEEEMIKIRSKLPPTYQCLMTSATLKDDMTTLKKLFM 223

Query: 441 RDPV 452
             PV
Sbjct: 224 TGPV 227



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/62 (38%), Positives = 33/62 (53%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+I+APT+EL  QI K+ + L   L       +   N  E+   LE   HVVV TPG++ 
Sbjct: 99  AVIIAPTKELITQIYKLFVKLSQALPFLQAINLCDINEEENSVWLEDRSHVVVTTPGKLL 158

Query: 247 DM 252
            M
Sbjct: 159 RM 160


>AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical
           protein C24H12.4a protein.
          Length = 634

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/64 (31%), Positives = 36/64 (56%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R  +   +   V+DEAD +LS G+++++  +   L    Q ++ SAT+ DD+  + + FM
Sbjct: 231 RPEYCTLVSYLVMDEADLLLSFGYEEEMIKIRSKLPPTYQCLMTSATLKDDMTTLKKLFM 290

Query: 441 RDPV 452
             PV
Sbjct: 291 TGPV 294



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 7/91 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT  F I ++Q++       D S+    A+I+APT+EL  QI K+ + L   L      
Sbjct: 138 GKTGAFLIPLVQKLIAESKTNDGSVGP-SAVIIAPTKELITQIYKLFVKLSQALPFLQAI 196

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDM 252
            +   N  E+   LE   HVVV TPG++  M
Sbjct: 197 NLCDINEEENSVWLEDRSHVVVTTPGKLLRM 227


>Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical
           protein F58G11.2 protein.
          Length = 960

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 10/93 (10%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQ-----ALILAPTRELAQQIQKVVIALGDHLNAK 150
           GKTA F + I+ +I     +T  +  Q     ALILAPTRELA QI + +     + +  
Sbjct: 430 GKTAAFGLPIIDKILRMDEETRNKARQDDGPLALILAPTRELAAQIHEALRTYCQNTDII 489

Query: 151 CHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
                G ++    + ++ +G  +++GT GR+ D
Sbjct: 490 VLLSYGQSDRARSLNEIRNGCDILIGTCGRIMD 522


>Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical
           protein C46F11.4 protein.
          Length = 811

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           V DEAD M   GF+ Q+  +   +  D Q ++ SAT    V  ++R  + DPVRI+
Sbjct: 418 VFDEADRMFDMGFEAQVKSISDHVRPDRQCLMFSATFKQKVERLARDALVDPVRIV 473



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA +     + I+ Q D    E   A+I+ PTRELA Q+ +         N       
Sbjct: 314 GKTAAYLWPAIVHIMDQPDLKAGEGPVAVIVVPTRELAIQVFQEAKKFCKVYNINPICAY 373

Query: 166 GGTNVREDIRQLES-GVHVVVGTPGRVYDMI 255
           GG +  E   +L++ G  +VV TPGR+ D++
Sbjct: 374 GGGSKWEQSNELQNEGAEMVVCTPGRIIDLV 404


>AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.19 protein.
          Length = 643

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT-NVREDIRQLESGVHVVVGTPGRV 243
           AL+L+PTREL+ QI                   GG  N ++ I +L  G H+++ TPGR+
Sbjct: 253 ALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRL 312

Query: 244 YDMI 255
            D++
Sbjct: 313 IDVM 316



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVF---KILSADVQV-ILLSATMPDDVLEVSRCFMRDP- 449
           +  VLDEAD ML  GF+ QI  +    ++ S + ++  + SAT P ++  +++ F+++  
Sbjct: 327 RYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSATFPKEIQLLAQDFLKENY 386

Query: 450 VRILVQKEELTLEGIKQ 500
           V + V +   T E I Q
Sbjct: 387 VFLAVGRVGSTSENIMQ 403


>U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 6/68 (8%)
 Frame = +3

Query: 285 KLFVLDEADEML-SRGFKDQIHDVFKILSA----DVQVILLSATMPDDVLEVSRCFMRDP 449
           + FVLDEAD M+ + GF   I  +    S     + Q ++ SAT PD V E +R F+R+ 
Sbjct: 494 RFFVLDEADRMIDAMGFGTDIETIVNYDSMPRKENRQTLMFSATFPDSVQEAARAFLREN 553

Query: 450 -VRILVQK 470
            V I + K
Sbjct: 554 YVMIAIDK 561



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIREC-------QALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + I+ ++  D ++          + +IL PTRELA QI             + 
Sbjct: 390 GKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMMEI 449

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRV 243
               GG  V  +  Q+E G  ++VGT GR+
Sbjct: 450 KPVYGGLAVGYNKGQIEKGATIIVGTVGRI 479


>L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 6/68 (8%)
 Frame = +3

Query: 285 KLFVLDEADEML-SRGFKDQIHDVFKILSA----DVQVILLSATMPDDVLEVSRCFMRDP 449
           + FVLDEAD M+ + GF   I  +    S     + Q ++ SAT PD V E +R F+R+ 
Sbjct: 494 RFFVLDEADRMIDAMGFGTDIETIVNYDSMPRKENRQTLMFSATFPDSVQEAARAFLREN 553

Query: 450 -VRILVQK 470
            V I + K
Sbjct: 554 YVMIAIDK 561



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIREC-------QALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + I+ ++  D ++          + +IL PTRELA QI             + 
Sbjct: 390 GKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMMEI 449

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRV 243
               GG  V  +  Q+E G  ++VGT GR+
Sbjct: 450 KPVYGGLAVGYNKGQIEKGATIIVGTVGRI 479


>AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line
           helicase protein 1 protein.
          Length = 763

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 6/68 (8%)
 Frame = +3

Query: 285 KLFVLDEADEML-SRGFKDQIHDVFKILSA----DVQVILLSATMPDDVLEVSRCFMRDP 449
           + FVLDEAD M+ + GF   I  +    S     + Q ++ SAT PD V E +R F+R+ 
Sbjct: 494 RFFVLDEADRMIDAMGFGTDIETIVNYDSMPRKENRQTLMFSATFPDSVQEAARAFLREN 553

Query: 450 -VRILVQK 470
            V I + K
Sbjct: 554 YVMIAIDK 561



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIREC-------QALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + I+ ++  D ++          + +IL PTRELA QI             + 
Sbjct: 390 GKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMMEI 449

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRV 243
               GG  V  +  Q+E G  ++VGT GR+
Sbjct: 450 KPVYGGLAVGYNKGQIEKGATIIVGTVGRI 479


>AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA
           helicase-3 protein.
          Length = 720

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 22/60 (36%), Positives = 29/60 (48%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           + +IL PTRELA QI             +     GG NV  +  Q+  G  ++VGT GRV
Sbjct: 377 RCIILTPTRELADQIYNEGRKFSYQSVMEIKPVYGGINVGYNKSQIMKGCTIIVGTIGRV 436


>AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line
           helicase protein 3 protein.
          Length = 720

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 22/60 (36%), Positives = 29/60 (48%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           + +IL PTRELA QI             +     GG NV  +  Q+  G  ++VGT GRV
Sbjct: 377 RCIILTPTRELADQIYNEGRKFSYQSVMEIKPVYGGINVGYNKSQIMKGCTIIVGTIGRV 436


>AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA
            helicase-4 protein.
          Length = 1156

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +1

Query: 70   LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE--SGVHVVVGTPGRV 243
            LI+APTREL  Q       L      KC    GG +   +++ L   S ++++V T GR+
Sbjct: 818  LIVAPTRELVNQTFTTARQLTYETGLKCGLAFGGYSRNANVQHLRSFSQLNILVATMGRL 877

Query: 244  YDMI 255
             D +
Sbjct: 878  QDFV 881


>AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line helicase
            protein 4 protein.
          Length = 1156

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +1

Query: 70   LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE--SGVHVVVGTPGRV 243
            LI+APTREL  Q       L      KC    GG +   +++ L   S ++++V T GR+
Sbjct: 818  LIVAPTRELVNQTFTTARQLTYETGLKCGLAFGGYSRNANVQHLRSFSQLNILVATMGRL 877

Query: 244  YDMI 255
             D +
Sbjct: 878  QDFV 881


>U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.
          Length = 974

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 20/60 (33%), Positives = 28/60 (46%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           + +IL PTREL  QI             +     GG  V  +  Q+E G  ++VGT GR+
Sbjct: 631 RCIILTPTRELTDQIYNEGRKFAYQTMMEIRPVYGGLAVGYNKGQIEKGATIIVGTVGRI 690



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 5/59 (8%)
 Frame = +3

Query: 285 KLFVLDEADEML-SRGFKDQIHDVFKILSA----DVQVILLSATMPDDVLEVSRCFMRD 446
           + FVLDEAD M+ + GF   I  +    S     + Q ++ SAT PD V E +R  +++
Sbjct: 705 RFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTLMFSATFPDSVQEAARNHLKE 763


>U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GLH-2
           protein.
          Length = 974

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 20/60 (33%), Positives = 28/60 (46%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           + +IL PTREL  QI             +     GG  V  +  Q+E G  ++VGT GR+
Sbjct: 631 RCIILTPTRELTDQIYNEGRKFAYQTMMEIRPVYGGLAVGYNKGQIEKGATIIVGTVGRI 690



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 5/59 (8%)
 Frame = +3

Query: 285 KLFVLDEADEML-SRGFKDQIHDVFKILSA----DVQVILLSATMPDDVLEVSRCFMRD 446
           + FVLDEAD M+ + GF   I  +    S     + Q ++ SAT PD V E +R  +++
Sbjct: 705 RFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTLMFSATFPDSVQEAARNHLKE 763


>AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line
           helicase protein 2 protein.
          Length = 974

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 20/60 (33%), Positives = 28/60 (46%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           + +IL PTREL  QI             +     GG  V  +  Q+E G  ++VGT GR+
Sbjct: 631 RCIILTPTRELTDQIYNEGRKFAYQTMMEIRPVYGGLAVGYNKGQIEKGATIIVGTVGRI 690



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 5/59 (8%)
 Frame = +3

Query: 285 KLFVLDEADEML-SRGFKDQIHDVFKILSA----DVQVILLSATMPDDVLEVSRCFMRD 446
           + FVLDEAD M+ + GF   I  +    S     + Q ++ SAT PD V E +R  +++
Sbjct: 705 RFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTLMFSATFPDSVQEAARNHLKE 763


>AL132948-1|CAC51077.1|  735|Caenorhabditis elegans Hypothetical
           protein Y39B6A.1 protein.
          Length = 735

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = -3

Query: 223 PPHEHHSPVGEYLHG-HWCHQCKHGI*HSSDH 131
           P HEHH   G++ HG H  H   HG  HS  H
Sbjct: 635 PHHEHHEHHGDHHHGSHGVHHGHHGTHHSLAH 666


>U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical
           protein C13F10.4 protein.
          Length = 2076

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 175 NVREDIRQ-LESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTR 342
           NV+++++Q LES +H VVG P R      + R      + + L  L+  C +  + +
Sbjct: 47  NVQKELQQQLESRLHTVVGPPTRKLIARCIGRVYALTGDIVSLNTLLNSCNDTLKVK 103


>L15201-3|AAA27944.1|  262|Caenorhabditis elegans Hypothetical
           protein C08C3.4 protein.
          Length = 262

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
 Frame = +3

Query: 318 LSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR--ILVQKEELTLEG 491
           LS  F D+++    +   +VQ  ++    PD+VLE  RC    P+R  + V+   L L  
Sbjct: 62  LSPYFADELY----VRKPNVQRYVIDQATPDEVLEFLRCITFCPMRKPLTVKNVSLVLTF 117

Query: 492 IKQFYM 509
             +F M
Sbjct: 118 ANRFEM 123


>AL032637-15|CAA21616.2|  370|Caenorhabditis elegans Hypothetical
           protein Y43F8C.16 protein.
          Length = 370

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 31/99 (31%), Positives = 41/99 (41%), Gaps = 2/99 (2%)
 Frame = -3

Query: 496 LIP-SRVSSSFCTSMRTGSLIKHRDTSNTSSGMVAESNMT*TSADKILKTSWIW-SLKPL 323
           LIP S +S+   TS RT S I    +SN  S     S  T T+  K    S    S  P+
Sbjct: 267 LIPTSTMSTITLTSDRT-STITSTGSSNPPSTSTVPSTTTSTTTPKPSSPSTAEASTTPV 325

Query: 322 DNISSASSRTKSLMVLA*SARRVSYHIHDLECPPPHEHH 206
              +  S+ T +  +LA S  R +         P H HH
Sbjct: 326 LTSNLTSALTSTSPLLASSTERTATTATSSVSTPKHPHH 364


>AF039039-1|AAB94180.2|  653|Caenorhabditis elegans Hypothetical
           protein T08B1.6 protein.
          Length = 653

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = +1

Query: 529 KLETLCDLYDTLSIAQAVIFC-NTRRKVG 612
           KLETLCD+ D   +   +IFC N +R  G
Sbjct: 134 KLETLCDIIDNCKL--EIIFCENAKRAEG 160


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,406,522
Number of Sequences: 27780
Number of extensions: 443319
Number of successful extensions: 1293
Number of sequences better than 10.0: 54
Number of HSP's better than 10.0 without gapping: 1141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1253
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1830096852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).