SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z22175-2|CAA80131.2|  520|Caenorhabditis elegans Hypothetical pr...    43   3e-04
Z11115-20|CAA77460.2|  520|Caenorhabditis elegans Hypothetical p...    43   3e-04
Z46937-1|CAA87056.2| 1036|Caenorhabditis elegans Hypothetical pr...    29   3.8  
U40799-2|AAA81480.1|  712|Caenorhabditis elegans Hypothetical pr...    29   5.1  
U41535-13|AAB63405.1| 1075|Caenorhabditis elegans Hypothetical p...    28   6.7  

>Z22175-2|CAA80131.2|  520|Caenorhabditis elegans Hypothetical
           protein ZK637.1 protein.
          Length = 520

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + A  ++  ++S + PA  CE  +++ Q  L+     SG + S+ FWG + D FGR+
Sbjct: 93  WMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRR 149


>Z11115-20|CAA77460.2|  520|Caenorhabditis elegans Hypothetical
           protein ZK637.1 protein.
          Length = 520

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + A  ++  ++S + PA  CE  +++ Q  L+     SG + S+ FWG + D FGR+
Sbjct: 93  WMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRR 149


>Z46937-1|CAA87056.2| 1036|Caenorhabditis elegans Hypothetical
           protein F43C1.1 protein.
          Length = 1036

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 7/82 (8%)
 Frame = +2

Query: 68  NIFFFSLTQNNG---SENRPENRKPHSQRHG-NLTRCHRRDGGLRNRAGQSRVRPLQPEC 235
           N+  F +T N+G   +EN PEN K HS+ +  N++   +   G +     SR      +C
Sbjct: 627 NLRHFDVTCNSGDFDTENFPENAKMHSKMNTINISEGSQNLFGFQIGVSGSRGMK-NKQC 685

Query: 236 FRSVRVP---FFASGVQNCIMS 292
            R VRV     F  G  N  MS
Sbjct: 686 IRQVRVENTFGFIDGGSNSYMS 707


>U40799-2|AAA81480.1|  712|Caenorhabditis elegans Hypothetical
           protein F42C5.4 protein.
          Length = 712

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = -3

Query: 119 RGDFLNHYFGLAKKKKYFFTINLRHIYTNKNMSRLT 12
           RG+ LN Y GL K K  +F IN      N+ M+RL+
Sbjct: 656 RGEMLNTY-GLLKSKCRYFFINSMKEEINEEMNRLS 690


>U41535-13|AAB63405.1| 1075|Caenorhabditis elegans Hypothetical
           protein F18A1.1 protein.
          Length = 1075

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%)
 Frame = -2

Query: 750 RLPQARNNLH-GVNWQERWIVRDF 682
           RLP  RNN    VNW   W +R+F
Sbjct: 62  RLPNGRNNREFTVNWDNIWSIRNF 85


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,963,669
Number of Sequences: 27780
Number of extensions: 464757
Number of successful extensions: 1098
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1032
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1098
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1935274832
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).