SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U23522-1|AAC46819.3|  962|Caenorhabditis elegans Hypothetical pr...    31   0.64 
Z77668-1|CAB01239.1|  576|Caenorhabditis elegans Hypothetical pr...    29   3.4  
U61952-2|AAB03160.1|  509|Caenorhabditis elegans Cytochrome p450...    29   3.4  
U41543-7|AAB37026.1|  284|Caenorhabditis elegans Hypothetical pr...    28   6.0  
AC024811-1|AAF60776.1|  494|Caenorhabditis elegans Dnaj domain (...    28   7.9  

>U23522-1|AAC46819.3|  962|Caenorhabditis elegans Hypothetical
           protein W06B4.3 protein.
          Length = 962

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +1

Query: 121 EVYVESENNVQKCIEIIIVHNVMVGETNQEIVIKKFS-FNTMKSFARY*IKKRKQ 282
           + YV  ENNV KCIE+I   N ++   +   +I KF+    +K      +K+ KQ
Sbjct: 749 QYYVTQENNVDKCIELINESNHLLTIQDLLPIIPKFTRVGALKPIIVDFLKRNKQ 803


>Z77668-1|CAB01239.1|  576|Caenorhabditis elegans Hypothetical
           protein R11G10.2 protein.
          Length = 576

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +2

Query: 485 GCRLFICVNLNKAWRRHMFKESIA 556
           GCRL++C +  KAW    + E I+
Sbjct: 468 GCRLYVCNSFYKAWDAQFYPELIS 491


>U61952-2|AAB03160.1|  509|Caenorhabditis elegans Cytochrome p450
           family protein 33E2 protein.
          Length = 509

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%)
 Frame = -1

Query: 413 FFPIFN*YQN-IFYYSNIIYKRCFII 339
           +FP F+ Y+N +FY    I+K CFI+
Sbjct: 223 YFPYFSGYKNGLFYELVFIFKMCFIV 248


>U41543-7|AAB37026.1|  284|Caenorhabditis elegans Hypothetical
           protein F46H5.5 protein.
          Length = 284

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 312 VSDHIEN*TILFSLLDLVSCKRFHC 238
           + DHIEN +I F  +  +SC+R  C
Sbjct: 70  IKDHIENWSIKFDHVFTISCRRVGC 94


>AC024811-1|AAF60776.1|  494|Caenorhabditis elegans Dnaj domain
           (prokaryotic heat shockprotein) protein 28 protein.
          Length = 494

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +3

Query: 234 QYNEIVCKILNQEEKTKLFSFLYDHLQTQLTSQEINDKTSLV 359
           Q   ++ K+   E     F +L DH  +Q TSQE  +K  L+
Sbjct: 97  QRASVLLKMGQLERAAADFRYLIDHSASQETSQEAQEKLELI 138


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,293,277
Number of Sequences: 27780
Number of extensions: 338752
Number of successful extensions: 759
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 740
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 759
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1724918872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).