SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U00036-4|AAK29850.1|  217|Caenorhabditis elegans Ribosomal prote...    94   7e-20
Z68314-7|CAA92662.2|  872|Caenorhabditis elegans Hypothetical pr...    30   1.2  
Z74030-3|CAA98437.2|  395|Caenorhabditis elegans Hypothetical pr...    29   2.8  
U41552-9|AAC69098.2| 1061|Caenorhabditis elegans Hypothetical pr...    27   8.6  

>U00036-4|AAK29850.1|  217|Caenorhabditis elegans Ribosomal protein,
           large subunitprotein 6 protein.
          Length = 217

 Score = 93.9 bits (223), Expect = 7e-20
 Identities = 46/84 (54%), Positives = 57/84 (67%), Gaps = 1/84 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILP-SGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGN 440
           GTV I+LAGRH GKRVV +  LP SGLLLVTGP   N  PLRRI Q +VI TS ++++  
Sbjct: 74  GTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSG 133

Query: 441 FKLPKHFNDDYFKKNKKCVKRTVN 512
            K+P+H ND+YFK+     K   N
Sbjct: 134 VKIPEHINDEYFKRKSTAQKTGKN 157


>Z68314-7|CAA92662.2|  872|Caenorhabditis elegans Hypothetical
           protein F07H5.8 protein.
          Length = 872

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -3

Query: 322 PTSTTLLPACLPARRMQTVPIFSWVGSCVHAC 227
           PT+ + +PAC PA   Q V   +   +C+ AC
Sbjct: 293 PTTASCIPACQPACTPQCVQAVTTTETCIPAC 324


>Z74030-3|CAA98437.2|  395|Caenorhabditis elegans Hypothetical
           protein D1054.5 protein.
          Length = 395

 Score = 28.7 bits (61), Expect = 2.8
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = -3

Query: 355 PVTKSRPLGRIPTSTTLLPACLPARRMQTVPIFSWVGS 242
           P+  S P G  P+    LPA   A+    +P F W  S
Sbjct: 111 PLPLSSPTGVSPSQYKTLPAGFGAKHQSNIPRFQWQSS 148


>U41552-9|AAC69098.2| 1061|Caenorhabditis elegans Hypothetical
           protein K07E3.1 protein.
          Length = 1061

 Score = 27.1 bits (57), Expect = 8.6
 Identities = 10/30 (33%), Positives = 19/30 (63%)
 Frame = -3

Query: 394 GIRRSGHELKAKGPVTKSRPLGRIPTSTTL 305
           G+  SG+ + +  P+T+    G +PTS+T+
Sbjct: 130 GVELSGNPIMSMAPITELATNGGLPTSSTI 159


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,483,325
Number of Sequences: 27780
Number of extensions: 259085
Number of successful extensions: 632
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 605
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 631
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1081316076
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).