SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z68218-2|CAA92472.1|  313|Caenorhabditis elegans Hypothetical pr...   103   1e-22
U80931-5|AAB38001.1|  313|Caenorhabditis elegans Hypothetical pr...   103   2e-22
Z82059-6|CAB04874.1|  300|Caenorhabditis elegans Hypothetical pr...   102   3e-22
AF003141-4|AAK21485.1|  300|Caenorhabditis elegans Hypothetical ...    94   1e-19
X76112-1|CAA53718.1|  300|Caenorhabditis elegans ADP/ATP translo...    87   1e-17
Z49207-2|CAA89069.1|  298|Caenorhabditis elegans Hypothetical pr...    74   1e-13
U64842-4|AAB37086.2|  306|Caenorhabditis elegans Hypothetical pr...    72   4e-13
Z68882-2|CAA93110.1|  306|Caenorhabditis elegans Hypothetical pr...    56   4e-08
U00052-8|AAK21421.2|  707|Caenorhabditis elegans Hypothetical pr...    40   0.002
Z81577-1|CAB04651.3|  289|Caenorhabditis elegans Hypothetical pr...    40   0.003
Z75532-5|CAD56651.1|  360|Caenorhabditis elegans Hypothetical pr...    38   0.006
Z75532-4|CAA99811.1|  310|Caenorhabditis elegans Hypothetical pr...    38   0.006
Z78542-7|CAB01750.1|  300|Caenorhabditis elegans Hypothetical pr...    36   0.042
AF003384-5|AAB54239.2|  324|Caenorhabditis elegans Uncoupling pr...    34   0.098
Z22180-4|CAA80178.1|  312|Caenorhabditis elegans Hypothetical pr...    34   0.13 
Z50873-3|CAA90761.4|  531|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z79755-2|CAB02107.1|  294|Caenorhabditis elegans Hypothetical pr...    28   6.4  
CU457741-10|CAM36351.1|  313|Caenorhabditis elegans Hypothetical...    28   8.5  

>Z68218-2|CAA92472.1|  313|Caenorhabditis elegans Hypothetical
           protein K01H12.2 protein.
          Length = 313

 Score =  103 bits (248), Expect = 1e-22
 Identities = 50/73 (68%), Positives = 56/73 (76%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           IISYP+DTVRRRMMMQSGR   D+LYKNT+ C   I K EG S  FKGA SNV RGTGGA
Sbjct: 243 IISYPWDTVRRRMMMQSGR--KDVLYKNTLDCAVKIIKNEGMSAMFKGALSNVFRGTGGA 300

Query: 181 FVLVLYDEIKKVL 219
            VL +YDEI+K +
Sbjct: 301 LVLAIYDEIQKFI 313


>U80931-5|AAB38001.1|  313|Caenorhabditis elegans Hypothetical
           protein T01B11.4 protein.
          Length = 313

 Score =  103 bits (246), Expect = 2e-22
 Identities = 49/73 (67%), Positives = 56/73 (76%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYP+DTVRRRMMMQSGR   D+LYKNT+ C   I K EG S  FKGA SNV RGTGGA
Sbjct: 243 ILSYPWDTVRRRMMMQSGR--KDVLYKNTLDCAVKIIKNEGMSAMFKGALSNVFRGTGGA 300

Query: 181 FVLVLYDEIKKVL 219
            VL +YDEI+K +
Sbjct: 301 LVLAIYDEIQKFI 313


>Z82059-6|CAB04874.1|  300|Caenorhabditis elegans Hypothetical
           protein T27E9.1a protein.
          Length = 300

 Score =  102 bits (244), Expect = 3e-22
 Identities = 50/73 (68%), Positives = 56/73 (76%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYP+DTVRRRMMMQSGR   DILYKNT+ C   I + EG S  FKGA SNV RGTGGA
Sbjct: 230 ILSYPWDTVRRRMMMQSGR--KDILYKNTLDCAKKIIQNEGMSAMFKGALSNVFRGTGGA 287

Query: 181 FVLVLYDEIKKVL 219
            VL +YDEI+K L
Sbjct: 288 LVLAIYDEIQKFL 300


>AF003141-4|AAK21485.1|  300|Caenorhabditis elegans Hypothetical
           protein W02D3.6 protein.
          Length = 300

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 44/72 (61%), Positives = 53/72 (73%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           +SYP+DTVRRRMMMQSGR   DILYKNT+ C   I K EG +  +KG  SNV R TGGA 
Sbjct: 231 LSYPWDTVRRRMMMQSGR--KDILYKNTLDCVRKIVKNEGITALYKGGLSNVFRATGGAL 288

Query: 184 VLVLYDEIKKVL 219
           VL +YDEI+ ++
Sbjct: 289 VLTIYDEIQHLI 300


>X76112-1|CAA53718.1|  300|Caenorhabditis elegans ADP/ATP
           translocase protein.
          Length = 300

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 46/73 (63%), Positives = 50/73 (68%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYP+DTVRRRMMMQSGR   DILYK            EG S  FKGA SNV RGTGGA
Sbjct: 230 ILSYPWDTVRRRMMMQSGR--KDILYKKHPRLRKEDHPNEGMSAMFKGALSNVFRGTGGA 287

Query: 181 FVLVLYDEIKKVL 219
            VL +YDEI+K L
Sbjct: 288 LVLAIYDEIQKFL 300


>Z49207-2|CAA89069.1|  298|Caenorhabditis elegans Hypothetical
           protein R07E3.4 protein.
          Length = 298

 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 33/73 (45%), Positives = 46/73 (63%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++ YP DTVRR MMMQSG+      Y +T  CW T+ K +G + F++GA +N LR TGGA
Sbjct: 228 MVCYPLDTVRRSMMMQSGKQIKQ--YTSTKDCWKTLYKKDGINGFYRGALTNSLRSTGGA 285

Query: 181 FVLVLYDEIKKVL 219
            ++  Y E  K +
Sbjct: 286 LIITFYYEFSKYM 298



 Score = 31.1 bits (67), Expect = 0.91
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFS 153
           YPFD  R R+ +   +  S   YK  + C   I  +EG + ++KG  S
Sbjct: 135 YPFDFARTRLALDVKKDGSR-KYKGMVDCLKKIKASEGVASWYKGLSS 181


>U64842-4|AAB37086.2|  306|Caenorhabditis elegans Hypothetical
           protein F25B4.7 protein.
          Length = 306

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 35/71 (49%), Positives = 45/71 (63%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           SYP DTVRRR+MM +G  K  + + NTI C   I   EG   FF GA  N +RGTG A V
Sbjct: 238 SYPLDTVRRRLMMGAG--KKTLPFNNTISCIKYIYTKEGPKAFFHGALVNAIRGTGAALV 295

Query: 187 LVLYDEIKKVL 219
           L +Y+E++K +
Sbjct: 296 LAIYNELQKYM 306



 Score = 35.5 bits (78), Expect = 0.042
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           YP D +R R+ +  G+ KSD  +     C   I K++G    +KG
Sbjct: 142 YPLDFIRTRLAIDLGKRKSDREFTGMFDCAKKIIKSDGVPGLYKG 186


>Z68882-2|CAA93110.1|  306|Caenorhabditis elegans Hypothetical
           protein C47E12.2 protein.
          Length = 306

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 28/70 (40%), Positives = 38/70 (54%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           ++YP+DTVRRRMM+     K  +           I   EG    +KGA +N+ R  GGA 
Sbjct: 240 LTYPWDTVRRRMMV-----KGQLSTSKAFSAARKIVHEEGVRGLYKGALANIFRSAGGAL 294

Query: 184 VLVLYDEIKK 213
           V+ LY+EI K
Sbjct: 295 VMALYEEIHK 304


>U00052-8|AAK21421.2|  707|Caenorhabditis elegans Hypothetical
           protein K02F3.2 protein.
          Length = 707

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           YP D V+ RM  Q  SG    +++YKN++ C+  + K EG    ++G    ++
Sbjct: 388 YPIDLVKTRMQNQRTSGSFVGEVMYKNSLDCFKKVVKFEGLLGLYRGLLPQIV 440



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AFVL 189
           P D ++ R+ + + RA     Y   I C   + K EG    +KG  + V R +   A  L
Sbjct: 581 PADVIKTRLQV-AARA-GQTTYNGVIDCARKLIKEEGPMSLWKGTAARVCRSSPQFAVTL 638

Query: 190 VLYDEIKKV 216
           + Y+ ++++
Sbjct: 639 LTYEVLQRL 647


>Z81577-1|CAB04651.3|  289|Caenorhabditis elegans Hypothetical
           protein R11.1 protein.
          Length = 289

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           I + PFD  + R+        +   Y  T+   + + K EG    +KG    V+R G GG
Sbjct: 213 IFNIPFDVAKSRIQGPQPDPFTR-KYSGTMQTISLVYKEEGFGALYKGLLPKVMRLGPGG 271

Query: 178 AFVLVLYDEI 207
           A +L++YDE+
Sbjct: 272 AVMLIVYDEV 281


>Z75532-5|CAD56651.1|  360|Caenorhabditis elegans Hypothetical
           protein C54G10.4b protein.
          Length = 360

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           +  +P DTV+ R+  QSG       Y+ T HC+  I + EG    +KG  S +L
Sbjct: 19  LAGHPLDTVKVRLQTQSGPTPQ---YRGTFHCFKLIVQKEGFRGLYKGMSSPLL 69


>Z75532-4|CAA99811.1|  310|Caenorhabditis elegans Hypothetical
           protein C54G10.4a protein.
          Length = 310

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           +  +P DTV+ R+  QSG       Y+ T HC+  I + EG    +KG  S +L
Sbjct: 19  LAGHPLDTVKVRLQTQSGPTPQ---YRGTFHCFKLIVQKEGFRGLYKGMSSPLL 69


>Z78542-7|CAB01750.1|  300|Caenorhabditis elegans Hypothetical
           protein F20D1.9 protein.
          Length = 300

 Score = 35.5 bits (78), Expect = 0.042
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGA 147
           P D ++ RM   + +  ++I+YKN    + TI K EG    FKGA
Sbjct: 222 PLDVIKTRMQTIN-KGANEIVYKNIPDAFVTIFKNEGPKALFKGA 265


>AF003384-5|AAB54239.2|  324|Caenorhabditis elegans Uncoupling
           protein (mitochondrialsubstrate carrier) protein 4
           protein.
          Length = 324

 Score = 34.3 bits (75), Expect = 0.098
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 12/83 (14%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDI-----------LYKNTIHCWATIAKTEGTSPFFKGA 147
           I+S P D V+ RMM Q  R + D            LYK  + C+  I K EG    +KG 
Sbjct: 236 IVSLPSDVVKTRMMDQI-RHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNEGFFSLYKGF 294

Query: 148 FSNVLRGTGGAFVL-VLYDEIKK 213
             + +R    +    V Y+EI+K
Sbjct: 295 LPSYIRMAPWSLTFWVSYEEIRK 317


>Z22180-4|CAA80178.1|  312|Caenorhabditis elegans Hypothetical
           protein K11H3.3 protein.
          Length = 312

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 28/72 (38%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGA---FSNVLRGTGGAF 183
           P D V+ RM  Q   AK    YKNT+ C   I K EG   F+KG     S V    G  F
Sbjct: 240 PIDVVKTRM--QGLEAKK---YKNTLDCAMQIWKKEGFFAFYKGTVPRLSRVCLDVGITF 294

Query: 184 VLVLYDEIKKVL 219
             ++YD I + L
Sbjct: 295 --MIYDSIIEFL 304



 Score = 28.3 bits (60), Expect = 6.4
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P +TV+ + +   G A+    YK  +H    I K EG    +KG  + + + G+  A   
Sbjct: 142 PMETVKVKFIHDQGLAQPK--YKGFVHGVGCIVKAEGLGGIYKGVTATMAKQGSNQAIRF 199

Query: 190 VLYDEIK 210
            + + +K
Sbjct: 200 FVMETLK 206


>Z50873-3|CAA90761.4|  531|Caenorhabditis elegans Hypothetical
           protein F17E5.2 protein.
          Length = 531

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP   VR R+  ++   K+       +  +  I +TEG +  ++G   N ++     
Sbjct: 453 LASYPLALVRTRLQARAISPKNSTQPDTMVGQFKHILQTEGFTGLYRGITPNFMKVIPAV 512

Query: 181 FV-LVLYDEIKKVL 219
            +  V+Y++++K L
Sbjct: 513 SISYVVYEKVRKQL 526


>Z79755-2|CAB02107.1|  294|Caenorhabditis elegans Hypothetical
           protein F43G9.3 protein.
          Length = 294

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSD-ILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           SYP D VRRR  MQ+GR  S     +  IH + T     G    +KG   N L+G
Sbjct: 222 SYPLDIVRRR--MQTGRIPSGWSPLRALIHIYHTEGLKRG---LYKGLSMNWLKG 271


>CU457741-10|CAM36351.1|  313|Caenorhabditis elegans Hypothetical
           protein C42C1.10 protein.
          Length = 313

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P D +R R++ Q        +Y  T+H    I + EG + +F+G   +V++
Sbjct: 139 PLDVIRTRLVAQKA---GHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQ 186


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,232,324
Number of Sequences: 27780
Number of extensions: 312796
Number of successful extensions: 635
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 589
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 624
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1851132448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).