SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U40941-5|AAA81710.1|  300|Caenorhabditis elegans Hypothetical pr...    30   2.3  
Z84574-5|CAB06541.1|  846|Caenorhabditis elegans Hypothetical pr...    29   3.1  
U40419-9|AAA81429.2| 1715|Caenorhabditis elegans Hypothetical pr...    28   9.5  
AL023815-5|CAA19428.2|  366|Caenorhabditis elegans Hypothetical ...    28   9.5  

>U40941-5|AAA81710.1|  300|Caenorhabditis elegans Hypothetical
           protein F35C8.5 protein.
          Length = 300

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 4/60 (6%)
 Frame = +2

Query: 122 WYSPVWLWPMAALNLQW--DTATPL--PEVTQEASALPLSAADTELLLWWSFWIPRWPFW 289
           W   +W++PMA + L W  DT  P+  P V +  S L +     +   +W  +I     W
Sbjct: 98  WNQLLWIYPMALVQLIWVPDTELPILAPTVFEMLSQLAIFFLAFDFTYFWFHYINHKVKW 157


>Z84574-5|CAB06541.1|  846|Caenorhabditis elegans Hypothetical
           protein F33E2.6 protein.
          Length = 846

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = -2

Query: 833 PPEVRPPKSFRPKSLRPKSTAQSPRP 756
           PP   PPK+  P+++RPK+ A    P
Sbjct: 575 PPRTEPPKTEAPRTVRPKTEAPMTVP 600


>U40419-9|AAA81429.2| 1715|Caenorhabditis elegans Hypothetical protein
            C27F2.8 protein.
          Length = 1715

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -2

Query: 833  PPEVRPPKSFRPKSLRPKSTAQSPRPIAPT 744
            P + R P     +S R +  A SP PIAPT
Sbjct: 1365 PSKARTPSKTPSQSNRAQHPASSPAPIAPT 1394


>AL023815-5|CAA19428.2|  366|Caenorhabditis elegans Hypothetical
           protein H28O16.2 protein.
          Length = 366

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGIWLV 751
           EE     +++KKP E+P++       H  PS  E      +NP  IW V
Sbjct: 67  EESVEAQMVMKKPSEEPELKRRKILIHMEPSITE------TNPMRIWTV 109


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,801,651
Number of Sequences: 27780
Number of extensions: 288177
Number of successful extensions: 1074
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 994
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1071
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2072006206
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).