SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82077-2|CAB04940.1|  722|Caenorhabditis elegans Hypothetical pr...    32   0.47 
AC006696-4|AAF39985.1|  215|Caenorhabditis elegans Hypothetical ...    31   0.63 
Z30974-5|CAH19087.1| 3183|Caenorhabditis elegans Hypothetical pr...    31   0.83 
Z30974-4|CAA83226.2| 3767|Caenorhabditis elegans Hypothetical pr...    31   0.83 
Z30423-15|CAH19103.1| 3183|Caenorhabditis elegans Hypothetical p...    31   0.83 
Z30423-14|CAC42345.1| 3767|Caenorhabditis elegans Hypothetical p...    31   0.83 
U53155-5|AAC48270.1|  303|Caenorhabditis elegans Collagen protei...    31   0.83 
AF139060-1|AAD29428.1| 3767|Caenorhabditis elegans transmembrane...    31   0.83 
AB072926-1|BAB69889.1|  303|Caenorhabditis elegans collagen prot...    31   0.83 
AF043706-2|AAB97604.2|  730|Caenorhabditis elegans Hypothetical ...    31   1.1  
AL132862-5|CAB70227.1|  419|Caenorhabditis elegans Hypothetical ...    30   1.9  
AL132862-4|CAB60533.1|  420|Caenorhabditis elegans Hypothetical ...    30   1.9  
AL117193-4|CAB54984.1|  335|Caenorhabditis elegans Hypothetical ...    30   1.9  
AC006809-3|AAY86286.1|  558|Caenorhabditis elegans Hypothetical ...    30   1.9  
Z81110-6|CAB03260.2| 1011|Caenorhabditis elegans Hypothetical pr...    29   2.5  
Z81110-2|CAB03259.1|  802|Caenorhabditis elegans Hypothetical pr...    29   2.5  
AL117193-5|CAB54985.1|  335|Caenorhabditis elegans Hypothetical ...    29   2.5  
AL117193-2|CAB54982.1|  335|Caenorhabditis elegans Hypothetical ...    29   2.5  
AF040642-7|AAB94952.1|  329|Caenorhabditis elegans Collagen prot...    29   2.5  
U80451-9|AAB37843.1|  285|Caenorhabditis elegans Collagen protei...    29   3.3  
AF024490-1|AAB70308.1|  334|Caenorhabditis elegans Hypothetical ...    29   3.3  
Z83227-3|CAB05726.2|  241|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z78018-7|CAB01449.2| 2577|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z78013-10|CAB01427.2| 2577|Caenorhabditis elegans Hypothetical p...    29   4.4  
AY314773-1|AAQ84880.1| 2596|Caenorhabditis elegans flamingo-like...    29   4.4  
AL117193-3|CAB54983.1|  335|Caenorhabditis elegans Hypothetical ...    28   5.8  
Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr...    28   7.7  
Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p...    28   7.7  
Z46676-3|CAA86663.1| 1244|Caenorhabditis elegans Hypothetical pr...    28   7.7  
U12966-7|AAK84534.1|  352|Caenorhabditis elegans Dumpy : shorter...    28   7.7  

>Z82077-2|CAB04940.1|  722|Caenorhabditis elegans Hypothetical
           protein W09C5.5 protein.
          Length = 722

 Score = 31.9 bits (69), Expect = 0.47
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +3

Query: 150 RCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           RC       C  P  P + P RP  LP  P +  G PVA  ++P
Sbjct: 139 RCSNAARNNCGAPGAPGAQPSRPPILPPIPTTPTGFPVAALSTP 182


>AC006696-4|AAF39985.1|  215|Caenorhabditis elegans Hypothetical
           protein W08E12.6 protein.
          Length = 215

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 7/58 (12%)
 Frame = +3

Query: 129 P*PASAPRCQARCCYPCSLPRGPCSVPGRPSCL-PR------GPCSVPGAPVAYHTSP 281
           P P   P C   C  P  +P  P  V G P C  P       GP   P AP+  +  P
Sbjct: 59  PPPCFGPACPPPCFGPACVPLAPIIVNGPPPCFGPACPPPCFGPACAPPAPIIVNGPP 116



 Score = 31.5 bits (68), Expect = 0.63
 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 7/58 (12%)
 Frame = +3

Query: 129 P*PASAPRCQARCCYPCSLPRGPCSVPGRPSCL-PR------GPCSVPGAPVAYHTSP 281
           P P   P C   C  P   P  P  V G P C  P       GP   P AP+  +  P
Sbjct: 87  PPPCFGPACPPPCFGPACAPPAPIIVNGPPPCFGPACPPPCFGPACAPSAPIIVNGPP 144



 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/41 (36%), Positives = 15/41 (36%)
 Frame = +3

Query: 129 P*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           P P   P C   C  P   P  P  V G P C   GP   P
Sbjct: 115 PPPCFGPACPPPCFGPACAPSAPIIVNGPPPCF--GPACPP 153


>Z30974-5|CAH19087.1| 3183|Caenorhabditis elegans Hypothetical protein
            K08E5.3b protein.
          Length = 3183

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGA 257
            P   PR PC  P R  C P G C   GA
Sbjct: 1925 PSPPPRHPCQDPERNDCHPAGTCRATGA 1952


>Z30974-4|CAA83226.2| 3767|Caenorhabditis elegans Hypothetical protein
            K08E5.3a protein.
          Length = 3767

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGA 257
            P   PR PC  P R  C P G C   GA
Sbjct: 2509 PSPPPRHPCQDPERNDCHPAGTCRATGA 2536


>Z30423-15|CAH19103.1| 3183|Caenorhabditis elegans Hypothetical
            protein K08E5.3b protein.
          Length = 3183

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGA 257
            P   PR PC  P R  C P G C   GA
Sbjct: 1925 PSPPPRHPCQDPERNDCHPAGTCRATGA 1952


>Z30423-14|CAC42345.1| 3767|Caenorhabditis elegans Hypothetical
            protein K08E5.3a protein.
          Length = 3767

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGA 257
            P   PR PC  P R  C P G C   GA
Sbjct: 2509 PSPPPRHPCQDPERNDCHPAGTCRATGA 2536


>U53155-5|AAC48270.1|  303|Caenorhabditis elegans Collagen protein
           43 protein.
          Length = 303

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPR-GPCSVPGAPVAYHTSP 281
           P++  +C+  CC P   P GP  VPG+P    R G    PG P    T+P
Sbjct: 94  PSANLQCEG-CCLPG--PPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAP 140


>AF139060-1|AAD29428.1| 3767|Caenorhabditis elegans transmembrane cell
            adhesion receptorMUA-3 precursor protein.
          Length = 3767

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGA 257
            P   PR PC  P R  C P G C   GA
Sbjct: 2509 PSPPPRHPCQDPERNDCHPAGTCRATGA 2536


>AB072926-1|BAB69889.1|  303|Caenorhabditis elegans collagen
           protein.
          Length = 303

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPR-GPCSVPGAPVAYHTSP 281
           P++  +C+  CC P   P GP  VPG+P    R G    PG P    T+P
Sbjct: 94  PSANLQCEG-CCLPG--PPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAP 140


>AF043706-2|AAB97604.2|  730|Caenorhabditis elegans Hypothetical
           protein ZC123.1 protein.
          Length = 730

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 18/51 (35%), Positives = 21/51 (41%)
 Frame = +3

Query: 129 P*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P P  AP    +CC      R PC    R  C P G C   G P  Y+ +P
Sbjct: 146 PPPPPAPEAPTQCCGSQPYGRTPC----RSGC-PNGDCGC-GRPCCYYQNP 190



 Score = 28.3 bits (60), Expect = 5.8
 Identities = 23/68 (33%), Positives = 29/68 (42%)
 Frame = +3

Query: 39  CFGRGVESWTSGCSRALLSR*SRFFPKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRP 218
           C G  +    S CS +  S   +  P  C P P   P+    CC P     GPC  P  P
Sbjct: 44  CSGCDLFPNRSCCSSSCCSS-QKPIPLACCP-PPPPPK---PCCQPAF---GPCC-PATP 94

Query: 219 SCLPRGPC 242
           +C P+ PC
Sbjct: 95  NCCPK-PC 101


>AL132862-5|CAB70227.1|  419|Caenorhabditis elegans Hypothetical
           protein Y73F8A.9 protein.
          Length = 419

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 15/61 (24%), Positives = 22/61 (36%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           AP CQ +C   C+LP  P     + SC     C     P     +  +    +S     +
Sbjct: 270 APVCQQQCAPQCTLPSAPACQQCQTSCQQTQQCQQQCIPQCQQPAAPQCQQCQSACQSPV 329

Query: 324 V 326
           V
Sbjct: 330 V 330


>AL132862-4|CAB60533.1|  420|Caenorhabditis elegans Hypothetical
           protein Y73F8A.8 protein.
          Length = 420

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 15/61 (24%), Positives = 22/61 (36%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           AP CQ +C   C+LP  P     + SC     C     P     +  +    +S     +
Sbjct: 271 APVCQQQCAPQCTLPSAPACQQCQTSCQQTQQCQQQCIPQCQQPAAPQCQQCQSACQSPV 330

Query: 324 V 326
           V
Sbjct: 331 V 331


>AL117193-4|CAB54984.1|  335|Caenorhabditis elegans Hypothetical
           protein Y105C5A.5 protein.
          Length = 335

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 15/61 (24%), Positives = 22/61 (36%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           AP CQ +C   C+LP  P     + SC     C     P     +  +    +S     +
Sbjct: 186 APVCQQQCAPQCTLPSAPACQQCQTSCQQTQQCQQQCIPQCQQPAAPQCQQCQSACQSPV 245

Query: 324 V 326
           V
Sbjct: 246 V 246


>AC006809-3|AAY86286.1|  558|Caenorhabditis elegans Hypothetical
           protein Y5H2A.4 protein.
          Length = 558

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/62 (25%), Positives = 24/62 (38%), Gaps = 1/62 (1%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGP-CSVPGAPVAYHTSPLRYSSAESVSSQN 320
           AP CQ +C   C+LP  P     + SC    P C    AP     +  +    +S     
Sbjct: 309 APVCQQQCAPQCTLPSAPVCQQCQTSCQQFAPVCQEQCAPQCQQPAAPQCQQCQSACQSP 368

Query: 321 IV 326
           ++
Sbjct: 369 VI 370



 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/61 (24%), Positives = 22/61 (36%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           AP CQ +C   C+LP  P     + SC     C     P     +  +    +S     +
Sbjct: 410 APVCQQQCAPQCTLPSAPACQQCQTSCQQTQQCHQQCIPQCQQPAAPQCQQCQSACQSPV 469

Query: 324 V 326
           V
Sbjct: 470 V 470


>Z81110-6|CAB03260.2| 1011|Caenorhabditis elegans Hypothetical
           protein T01D3.3b protein.
          Length = 1011

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 1/68 (1%)
 Frame = +3

Query: 144 APRCQARC-CYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQN 320
           AP CQ  C C P  + R   S P R +C+PRG C      +       +Y +  S    +
Sbjct: 318 APGCQPGCICLPGYIRRD--SSP-RSACVPRGLCQAYDLTIRCADEKRQYQTCGSACPIS 374

Query: 321 IVRHDQPQ 344
               +QP+
Sbjct: 375 CATRNQPR 382


>Z81110-2|CAB03259.1|  802|Caenorhabditis elegans Hypothetical
           protein T01D3.3a protein.
          Length = 802

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 1/68 (1%)
 Frame = +3

Query: 144 APRCQARC-CYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQN 320
           AP CQ  C C P  + R   S P R +C+PRG C      +       +Y +  S    +
Sbjct: 109 APGCQPGCICLPGYIRRD--SSP-RSACVPRGLCQAYDLTIRCADEKRQYQTCGSACPIS 165

Query: 321 IVRHDQPQ 344
               +QP+
Sbjct: 166 CATRNQPR 173


>AL117193-5|CAB54985.1|  335|Caenorhabditis elegans Hypothetical
           protein Y105C5A.6 protein.
          Length = 335

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/61 (24%), Positives = 22/61 (36%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           AP CQ +C   C+LP  P     + SC     C     P     +  +    +S     +
Sbjct: 186 APVCQQQCTPQCTLPSAPACQQCQTSCQQTQQCQQQCIPQCQQPAAPQCQQCQSACQSPV 245

Query: 324 V 326
           V
Sbjct: 246 V 246


>AL117193-2|CAB54982.1|  335|Caenorhabditis elegans Hypothetical
           protein Y105C5A.3 protein.
          Length = 335

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/61 (24%), Positives = 22/61 (36%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           AP CQ +C   C+LP  P     + SC     C     P     +  +    +S     +
Sbjct: 186 APVCQQQCTPQCTLPSAPACQQCQTSCQQTQQCQQQCIPQCQQPAAPQCQQCQSACQSPV 245

Query: 324 V 326
           V
Sbjct: 246 V 246


>AF040642-7|AAB94952.1|  329|Caenorhabditis elegans Collagen protein
           68 protein.
          Length = 329

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           C+ C  P GP   PG+    P+GP   PGAP
Sbjct: 183 CFDC--PTGPPGPPGKQG--PKGPNGEPGAP 209


>U80451-9|AAB37843.1|  285|Caenorhabditis elegans Collagen protein
           73 protein.
          Length = 285

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           C+ C  P GP    G P   P+GP   PGAP
Sbjct: 138 CFEC--PPGPAGNAGNPG--PKGPPGQPGAP 164


>AF024490-1|AAB70308.1|  334|Caenorhabditis elegans Hypothetical
           protein C02H6.1 protein.
          Length = 334

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 1/47 (2%)
 Frame = +3

Query: 159 ARCCYPCS-LPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSS 296
           ARC      LP       G    LP  P  +PG P AYH  PL+  S
Sbjct: 247 ARCLASMGILPSDTRDNDGSCRFLPFRPSEMPGIPEAYHYYPLKNGS 293


>Z83227-3|CAB05726.2|  241|Caenorhabditis elegans Hypothetical
           protein F45B8.3 protein.
          Length = 241

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 5/49 (10%)
 Frame = +3

Query: 129 P*PASAPRCQARCCYPCSLPRGPCSVPG-RPS-CLPRGPCSVP---GAP 260
           P P SAP C    C    +P  PC  P  RP+ C+   P  VP   GAP
Sbjct: 154 PPPPSAPAC----CVAAPVPTNPCCQPAPRPAPCVCSAPRPVPCRCGAP 198


>Z78018-7|CAB01449.2| 2577|Caenorhabditis elegans Hypothetical
           protein F15B9.7 protein.
          Length = 2577

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 22/81 (27%), Positives = 31/81 (38%), Gaps = 7/81 (8%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRP-----SCLPRGPCSVPGAPVAYHTSPLRYSSA 299
           P + P   +    P S P  PC  PG+P            C VPG P + H+S +     
Sbjct: 41  PCAVPSSNSVIWLPASRP--PCLHPGQPIIHWPDLSDNLACPVPGLPDSVHSSQISLLEG 98

Query: 300 ES--VSSQNIVRHDQPQTIQY 356
           E   ++ + I   D P    Y
Sbjct: 99  EGLLLTKERICFFDGPIDFHY 119


>Z78013-10|CAB01427.2| 2577|Caenorhabditis elegans Hypothetical
           protein F15B9.7 protein.
          Length = 2577

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 22/81 (27%), Positives = 31/81 (38%), Gaps = 7/81 (8%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRP-----SCLPRGPCSVPGAPVAYHTSPLRYSSA 299
           P + P   +    P S P  PC  PG+P            C VPG P + H+S +     
Sbjct: 41  PCAVPSSNSVIWLPASRP--PCLHPGQPIIHWPDLSDNLACPVPGLPDSVHSSQISLLEG 98

Query: 300 ES--VSSQNIVRHDQPQTIQY 356
           E   ++ + I   D P    Y
Sbjct: 99  EGLLLTKERICFFDGPIDFHY 119


>AY314773-1|AAQ84880.1| 2596|Caenorhabditis elegans flamingo-like
           protein FMI-1 protein.
          Length = 2596

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 22/81 (27%), Positives = 31/81 (38%), Gaps = 7/81 (8%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRP-----SCLPRGPCSVPGAPVAYHTSPLRYSSA 299
           P + P   +    P S P  PC  PG+P            C VPG P + H+S +     
Sbjct: 41  PCAVPSSNSVIWLPASRP--PCLHPGQPIIHWPDLSDNLACPVPGLPDSVHSSQISLLEG 98

Query: 300 ES--VSSQNIVRHDQPQTIQY 356
           E   ++ + I   D P    Y
Sbjct: 99  EGLLLTKERICFFDGPIDFHY 119


>AL117193-3|CAB54983.1|  335|Caenorhabditis elegans Hypothetical
           protein Y105C5A.4 protein.
          Length = 335

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 14/61 (22%), Positives = 21/61 (34%)
 Frame = +3

Query: 144 APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           AP CQ +C   C+ P  P     + SC     C     P     +  +    +S     +
Sbjct: 186 APVCQQQCAPQCTFPSAPACQQCQTSCQQTQQCQQQCIPQCQQPAAPQCQQCQSACQSPV 245

Query: 324 V 326
           V
Sbjct: 246 V 246


>Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 265 PTTLLHSATPRLNLSRPKTSSVMTSP 342
           PTT L ++T   + + P TS+V TSP
Sbjct: 428 PTTTLTTSTASTSTTEPSTSTVTTSP 453


>Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 265 PTTLLHSATPRLNLSRPKTSSVMTSP 342
           PTT L ++T   + + P TS+V TSP
Sbjct: 428 PTTTLTTSTASTSTTEPSTSTVTTSP 453


>Z46676-3|CAA86663.1| 1244|Caenorhabditis elegans Hypothetical
           protein C08B11.3 protein.
          Length = 1244

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -2

Query: 109 KRLQRESSAREQPEVQLSTPRPKHT 35
           +++QRE+  REQ   Q S P P HT
Sbjct: 548 QQVQRENLNREQYSTQSSQPHPPHT 572


>U12966-7|AAK84534.1|  352|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 17 protein.
          Length = 352

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           P++ P  +  C    S P GP    G P     GP  +PG P
Sbjct: 137 PSAGPGDKCNCNTENSCPAGPAGPKGTPG--HDGPDGIPGVP 176


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,772,429
Number of Sequences: 27780
Number of extensions: 242611
Number of successful extensions: 934
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 809
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 917
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).