SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z46381-2|CAA86515.1|  202|Caenorhabditis elegans Hypothetical pr...   160   7e-40
U31528-1|AAA74904.1|  202|Caenorhabditis elegans 60S ribosomal p...   160   7e-40
U64848-10|AAB04888.1|  168|Caenorhabditis elegans Hypothetical p...    33   0.18 
U70857-6|AAD31051.1|  189|Caenorhabditis elegans Hypothetical pr...    29   2.2  
AC024842-4|AAY43991.1|  703|Caenorhabditis elegans Hypothetical ...    29   2.2  
AC024842-3|AAP13732.1| 1111|Caenorhabditis elegans Hypothetical ...    29   2.2  
AC024842-2|ABA00150.1|  604|Caenorhabditis elegans Hypothetical ...    29   2.2  
AC024842-1|AAF59622.4| 1127|Caenorhabditis elegans Hypothetical ...    29   2.2  
Z70213-9|CAA94177.1| 1520|Caenorhabditis elegans Hypothetical pr...    28   5.1  
Z49069-5|CAA88867.1| 1520|Caenorhabditis elegans Hypothetical pr...    28   5.1  
U50069-1|AAB37559.2|  884|Caenorhabditis elegans Hypothetical pr...    27   8.9  

>Z46381-2|CAA86515.1|  202|Caenorhabditis elegans Hypothetical
           protein M01F1.2 protein.
          Length = 202

 Score =  160 bits (389), Expect = 7e-40
 Identities = 82/163 (50%), Positives = 103/163 (63%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G SN+AI+IDG+ HLLGRLA+++AK LL+G+KVVV+R E+I ISGNF R+KLK MSFLRK
Sbjct: 2   GLSNRAIIIDGKNHLLGRLASIVAKKLLQGDKVVVLRAEEIVISGNFHRSKLKYMSFLRK 61

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           RCN+NPARG FH+RAP KI W+TV      K +     L   +     +           
Sbjct: 62  RCNINPARGAFHYRAPGKIFWRTVRGMLPHKTNRGNEALKN-LRAYEGVPAKYQKTKSLH 120

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGK 491
                          C VGRLSHE+GW+++DVV KLE KRK K
Sbjct: 121 APSASRFRLQPRRKFCVVGRLSHEVGWQFQDVVAKLEAKRKVK 163



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/50 (42%), Positives = 26/50 (52%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT RG  AL+ LR Y+G P  +              F L+P RK
Sbjct: 86  RGMLPHKTNRGNEALKNLRAYEGVPAKYQK-TKSLHAPSASRFRLQPRRK 134


>U31528-1|AAA74904.1|  202|Caenorhabditis elegans 60S ribosomal
           protein L13A protein.
          Length = 202

 Score =  160 bits (389), Expect = 7e-40
 Identities = 82/163 (50%), Positives = 103/163 (63%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G SN+AI+IDG+ HLLGRLA+++AK LL+G+KVVV+R E+I ISGNF R+KLK MSFLRK
Sbjct: 2   GLSNRAIIIDGKNHLLGRLASIVAKKLLQGDKVVVLRAEEIVISGNFHRSKLKYMSFLRK 61

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           RCN+NPARG FH+RAP KI W+TV      K +     L   +     +           
Sbjct: 62  RCNINPARGAFHYRAPGKIFWRTVRGMLPHKTNRGNEALKN-LRAYEGVPAKYQKTKSLH 120

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGK 491
                          C VGRLSHE+GW+++DVV KLE KRK K
Sbjct: 121 APSASRFRLQPRRKFCVVGRLSHEVGWQFQDVVAKLEAKRKVK 163



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/50 (42%), Positives = 26/50 (52%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT RG  AL+ LR Y+G P  +              F L+P RK
Sbjct: 86  RGMLPHKTNRGNEALKNLRAYEGVPAKYQK-TKSLHAPSASRFRLQPRRK 134


>U64848-10|AAB04888.1|  168|Caenorhabditis elegans Hypothetical
           protein C50E3.2 protein.
          Length = 168

 Score = 33.1 bits (72), Expect = 0.18
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = -2

Query: 533 VILLSFFSWHSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIYGQV 390
           V L+ F+S   L  L + L   L NNI VFPSN + +++ MT+ +G++
Sbjct: 6   VFLICFYSISCLTDLDI-LNVALENNILVFPSN-ISEASGMTLFHGRI 51


>U70857-6|AAD31051.1|  189|Caenorhabditis elegans Hypothetical
           protein C10G8.3 protein.
          Length = 189

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -1

Query: 492 PCPSSCLQAYEQHHGISIQFHGTVCLHD 409
           PCP       E+ HGI++Q  G  CLH+
Sbjct: 143 PCPIGQTIVREKIHGITVQLLGKRCLHN 170


>AC024842-4|AAY43991.1|  703|Caenorhabditis elegans Hypothetical
           protein Y59H11AR.2c protein.
          Length = 703

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 500 ESAMKRNLRGSPRMLVRKCRRRQTPFHYH 586
           E +MK   +GSP M++  CR    P ++H
Sbjct: 198 EDSMKAYCKGSPEMIMSLCRPETVPENFH 226


>AC024842-3|AAP13732.1| 1111|Caenorhabditis elegans Hypothetical
           protein Y59H11AR.2b protein.
          Length = 1111

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 500 ESAMKRNLRGSPRMLVRKCRRRQTPFHYH 586
           E +MK   +GSP M++  CR    P ++H
Sbjct: 606 EDSMKAYCKGSPEMIMSLCRPETVPENFH 634


>AC024842-2|ABA00150.1|  604|Caenorhabditis elegans Hypothetical
           protein Y59H11AR.2d protein.
          Length = 604

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 500 ESAMKRNLRGSPRMLVRKCRRRQTPFHYH 586
           E +MK   +GSP M++  CR    P ++H
Sbjct: 99  EDSMKAYCKGSPEMIMSLCRPETVPENFH 127


>AC024842-1|AAF59622.4| 1127|Caenorhabditis elegans Hypothetical
           protein Y59H11AR.2a protein.
          Length = 1127

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 500 ESAMKRNLRGSPRMLVRKCRRRQTPFHYH 586
           E +MK   +GSP M++  CR    P ++H
Sbjct: 622 EDSMKAYCKGSPEMIMSLCRPETVPENFH 650


>Z70213-9|CAA94177.1| 1520|Caenorhabditis elegans Hypothetical
           protein K12D12.1 protein.
          Length = 1520

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 9/31 (29%), Positives = 20/31 (64%)
 Frame = +1

Query: 547 EKVSKATNTISLPSSKFLWIQFRDLRNYNQK 639
           EK SKA +++ +  +   W++F+ + + N+K
Sbjct: 431 EKFSKAASSVGITDAVMSWVRFKQMDDLNKK 461


>Z49069-5|CAA88867.1| 1520|Caenorhabditis elegans Hypothetical
           protein K12D12.1 protein.
          Length = 1520

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 9/31 (29%), Positives = 20/31 (64%)
 Frame = +1

Query: 547 EKVSKATNTISLPSSKFLWIQFRDLRNYNQK 639
           EK SKA +++ +  +   W++F+ + + N+K
Sbjct: 431 EKFSKAASSVGITDAVMSWVRFKQMDDLNKK 461


>U50069-1|AAB37559.2|  884|Caenorhabditis elegans Hypothetical
           protein C09B9.3 protein.
          Length = 884

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%)
 Frame = -2

Query: 635 WL*FLKSLNCIHRNLDDGSEMVFVA----FDTFSPASLVILLSFF 513
           WL    ++  I+R LD+  + +F +    F  F P+ L  +LSFF
Sbjct: 39  WLVLYYTVLAIYRTLDEERKKIFRSNIEHFINFEPSILTFMLSFF 83


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,745,921
Number of Sequences: 27780
Number of extensions: 329166
Number of successful extensions: 885
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 853
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 885
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1476380920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).