SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical pr...   144   6e-35
M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein ( C.ele...   140   9e-34
Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical pr...   126   9e-30
Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical pr...   126   9e-30
Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical pr...   125   2e-29
U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock prot...   111   4e-25
M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C. el...   111   4e-25
U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock prot...    99   3e-21
M28528-1|AAA28076.1|  288|Caenorhabditis elegans protein ( C.ele...    97   1e-20
AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock pr...    97   1e-20
Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical p...    51   6e-07
Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical pr...    51   6e-07
X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.        40   0.002
AF025464-2|AAN84804.1|  496|Caenorhabditis elegans Prion-like-(q...    31   0.86 
AF025464-1|AAN84805.1|  529|Caenorhabditis elegans Prion-like-(q...    31   0.86 
Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical pr...    30   1.1  
Z66500-11|CAC42334.1|  625|Caenorhabditis elegans Hypothetical p...    30   1.1  
Z66500-10|CAB61022.1|  666|Caenorhabditis elegans Hypothetical p...    30   1.1  
Z66500-9|CAA91307.1|  672|Caenorhabditis elegans Hypothetical pr...    30   1.1  
Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical p...    30   1.1  
AF070920-1|AAC24231.1|  554|Caenorhabditis elegans cytoplasmic s...    30   1.1  
AF063244-1|AAC16434.1|  666|Caenorhabditis elegans cytoplasmic s...    30   1.1  
AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator comp...    30   1.1  
Z81097-1|CAB03175.1|  491|Caenorhabditis elegans Hypothetical pr...    28   4.6  
Z78546-6|CAB54307.1|  642|Caenorhabditis elegans Hypothetical pr...    28   4.6  
Z78545-5|CAB01764.2|  642|Caenorhabditis elegans Hypothetical pr...    28   4.6  
Z72516-1|CAA96687.2|  156|Caenorhabditis elegans Hypothetical pr...    28   4.6  
U96695-1|AAB57697.1|  491|Caenorhabditis elegans deoxyuridinetri...    28   4.6  
Z99281-44|CAJ76963.1|   96|Caenorhabditis elegans Hypothetical p...    28   6.0  
AF045645-3|AAC02610.2|  193|Caenorhabditis elegans Hypothetical ...    28   6.0  
AF026208-2|AAB71269.3|  774|Caenorhabditis elegans Prion-like-(q...    28   6.0  
AF024502-4|AAB70374.1|  675|Caenorhabditis elegans Hypothetical ...    28   6.0  
AF000263-12|AAO21392.1|  838|Caenorhabditis elegans Hypothetical...    27   8.0  
AF000263-11|AAL77184.1|  866|Caenorhabditis elegans Hypothetical...    27   8.0  
AF000263-8|AAK21461.1|  924|Caenorhabditis elegans Hypothetical ...    27   8.0  
AF000263-7|AAK21463.1|  925|Caenorhabditis elegans Hypothetical ...    27   8.0  

>Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical
           protein F26D10.3 protein.
          Length = 640

 Score =  144 bits (348), Expect = 6e-35
 Identities = 76/133 (57%), Positives = 91/133 (68%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 432 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSA 491

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K+N+  +   K    +      +      +     QK+ I  +  +     +  
Sbjct: 492 TDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNL- 550

Query: 407 SATMEDEKLKEKI 445
             T+EDEKLK+KI
Sbjct: 551 KQTIEDEKLKDKI 563


>M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 70A gene, complete cds. ).
          Length = 640

 Score =  140 bits (338), Expect = 9e-34
 Identities = 75/133 (56%), Positives = 89/133 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 432 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSA 491

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K  +  +   K    +      +      +     QK+ I  +  +     +  
Sbjct: 492 TDKSTGKAKQITITNDKDRFSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNL- 550

Query: 407 SATMEDEKLKEKI 445
             T+EDEKLK+KI
Sbjct: 551 KQTIEDEKLKDKI 563


>Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.5 protein.
          Length = 645

 Score =  126 bits (305), Expect = 9e-30
 Identities = 63/109 (57%), Positives = 76/109 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 432 YADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSA 491

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQ 373
            +KST K NR  +   K    +      +   +  E     Q+E +Q +
Sbjct: 492 EDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQAR 540


>Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.4 protein.
          Length = 645

 Score =  126 bits (305), Expect = 9e-30
 Identities = 63/109 (57%), Positives = 76/109 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 432 YADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSA 491

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQ 373
            +KST K NR  +   K    +      +   +  E     Q+E +Q +
Sbjct: 492 EDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQAR 540


>Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical
           protein C12C8.1 protein.
          Length = 643

 Score =  125 bits (302), Expect = 2e-29
 Identities = 57/77 (74%), Positives = 66/77 (85%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMT+DN+ LG FELTGIPPAPRGVPQ++VTFDIDANGILNVSA
Sbjct: 432 YADNQPGVSIQVYEGERAMTRDNHRLGTFELTGIPPAPRGVPQVDVTFDIDANGILNVSA 491

Query: 227 IEKSTNKENRSPLPTTK 277
            +KST + NR  +   K
Sbjct: 492 ADKSTGRSNRITIRNEK 508



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMK 408
           +  +ITI N+KGRLS+ +I+RMVNEA+++  E D A+ D    R       F +K
Sbjct: 498 RSNRITIRNEKGRLSQADIDRMVNEAKQFERE-DAAQRDRISSRNQLEAYAFQVK 551


>U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock protein
           protein 3 protein.
          Length = 661

 Score =  111 bits (267), Expect = 4e-25
 Identities = 50/69 (72%), Positives = 60/69 (86%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQP V IQVFEGER MTKDN+ LGKF+LTG+PPAPRGVPQIEVTF+ID NGIL+V+A 
Sbjct: 460 ADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAE 519

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 520 DKGTGNKNK 528



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 21/34 (61%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RLS E+IERM+N+AEK+  +D K K
Sbjct: 528 KITITNDQNRLSPEDIERMINDAEKFAEDDKKVK 561


>M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C.
           elegans BiP (hsp3)gene, complete cds. ).
          Length = 661

 Score =  111 bits (267), Expect = 4e-25
 Identities = 50/69 (72%), Positives = 60/69 (86%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQP V IQVFEGER MTKDN+ LGKF+LTG+PPAPRGVPQIEVTF+ID NGIL+V+A 
Sbjct: 460 ADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAE 519

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 520 DKGTGNKNK 528



 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 20/34 (58%), Positives = 27/34 (79%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RLS E+IE M+N+AEK+  +D K K
Sbjct: 528 KITITNDQNRLSPEDIEAMINDAEKFAEDDKKVK 561


>U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock protein
           protein 6 protein.
          Length = 657

 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+VF+GER M   N LLG+F L GIPPAPRGVPQ+EVTFDIDANGI+NVSA 
Sbjct: 455 ADGQTQVQIKVFQGEREMATSNKLLGQFSLVGIPPAPRGVPQVEVTFDIDANGIVNVSAR 514

Query: 230 EKSTNKENR 256
           ++ T KE +
Sbjct: 515 DRGTGKEQQ 523



 Score = 35.5 bits (78), Expect = 0.030
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE M+ EAEK   ED K K
Sbjct: 521 EQQIVIQSSGGLSKDQIENMIKEAEKNAAEDAKRK 555


>M28528-1|AAA28076.1|  288|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 4 gene, 3' end. ).
          Length = 288

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 43/69 (62%), Positives = 55/69 (79%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D+Q  V I ++EGER M  DN+ LG F++TGIPPAPRGVPQIEVTF+ID NGIL+VSA 
Sbjct: 88  ADSQSAVSIVIYEGERPMVMDNHKLGNFDVTGIPPAPRGVPQIEVTFEIDVNGILHVSAE 147

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 148 DKGTGNKNK 156



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           ++TITND  RLS E+IERM+N+A+K+  +D   K
Sbjct: 156 KLTITNDHNRLSPEDIERMINDADKFAADDQAQK 189


>AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock
           protein protein 4 protein.
          Length = 657

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 43/69 (62%), Positives = 55/69 (79%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D+Q  V I ++EGER M  DN+ LG F++TGIPPAPRGVPQIEVTF+ID NGIL+VSA 
Sbjct: 457 ADSQSAVSIVIYEGERPMVMDNHKLGNFDVTGIPPAPRGVPQIEVTFEIDVNGILHVSAE 516

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 517 DKGTGNKNK 525



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMK 408
           ++TITND  RLS E+IERM+N+A+K+   DD+A+ +    R       + MK
Sbjct: 525 KLTITNDHNRLSPEDIERMINDADKFA-ADDQAQKEKVESRNELEAYAYQMK 575


>Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + + V+EGER +   N  LG+  L  I P  RG   +++T ++D NGIL  +A++
Sbjct: 429 DFQTSINVPVYEGERVLCSHNRQLGEISLP-IQPKRRGESVVDITLEVDYNGILQATALD 487

Query: 233 KSTNK 247
            +T K
Sbjct: 488 LNTKK 492


>Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + + V+EGER +   N  LG+  L  I P  RG   +++T ++D NGIL  +A++
Sbjct: 429 DFQTSINVPVYEGERVLCSHNRQLGEISLP-IQPKRRGESVVDITLEVDYNGILQATALD 487

Query: 233 KSTNK 247
            +T K
Sbjct: 488 LNTKK 492


>X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.
          Length = 487

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/33 (54%), Positives = 22/33 (66%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGI 148
           +D Q  V I+VF+GER M   N LLG+F L GI
Sbjct: 455 ADGQTQVQIKVFQGEREMATSNKLLGQFSLVGI 487


>AF025464-2|AAN84804.1|  496|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 42,
           isoform a protein.
          Length = 496

 Score = 30.7 bits (66), Expect = 0.86
 Identities = 17/64 (26%), Positives = 27/64 (42%)
 Frame = +2

Query: 170 PQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTR 349
           PQ +V    D    LN +   K  N   R  + T+   + +KR + WL  Q+       R
Sbjct: 130 PQSDVVTSPDIQNALNSATSSKCNNGGARCQM-TSPAAASKKRVNAWLKEQQEAAAEQQR 188

Query: 350 QKET 361
           + +T
Sbjct: 189 RAQT 192


>AF025464-1|AAN84805.1|  529|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 42,
           isoform b protein.
          Length = 529

 Score = 30.7 bits (66), Expect = 0.86
 Identities = 17/64 (26%), Positives = 27/64 (42%)
 Frame = +2

Query: 170 PQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTR 349
           PQ +V    D    LN +   K  N   R  + T+   + +KR + WL  Q+       R
Sbjct: 152 PQSDVVTSPDIQNALNSATSSKCNNGGARCQM-TSPAAASKKRVNAWLKEQQEAAAEQQR 210

Query: 350 QKET 361
           + +T
Sbjct: 211 RAQT 214


>Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical
           protein K08F8.6 protein.
          Length = 2862

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +2

Query: 158 PRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTT 274
           P+G+P+IEV  D + +  + +  +    N + +S LP T
Sbjct: 672 PKGIPEIEVDKDFELHNDIKIPKVPNDDNYKPKSFLPIT 710


>Z66500-11|CAC42334.1|  625|Caenorhabditis elegans Hypothetical
           protein T05C12.6c protein.
          Length = 625

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 173 QIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQ 352
           ++E T ++   G     A+     +     L TT  +SP      WL R+R  E+ MT  
Sbjct: 481 RVEATTEVTYVGSPAPHALAARVGRNIPHRLETT-TLSPVAHDQTWLRRRRDCESPMTND 539

Query: 353 KETIQGQECIGI 388
             ++ G+  IG+
Sbjct: 540 YASMVGESQIGM 551


>Z66500-10|CAB61022.1|  666|Caenorhabditis elegans Hypothetical
           protein T05C12.6b protein.
          Length = 666

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 173 QIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQ 352
           ++E T ++   G     A+     +     L TT  +SP      WL R+R  E+ MT  
Sbjct: 522 RVEATTEVTYVGSPAPHALAARVGRNIPHRLETT-TLSPVAHDQTWLRRRRDCESPMTND 580

Query: 353 KETIQGQECIGI 388
             ++ G+  IG+
Sbjct: 581 YASMVGESQIGM 592


>Z66500-9|CAA91307.1|  672|Caenorhabditis elegans Hypothetical
           protein T05C12.6a protein.
          Length = 672

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 173 QIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQ 352
           ++E T ++   G     A+     +     L TT  +SP      WL R+R  E+ MT  
Sbjct: 522 RVEATTEVTYVGSPAPHALAARVGRNIPHRLETT-TLSPVAHDQTWLRRRRDCESPMTND 580

Query: 353 KETIQGQECIGI 388
             ++ G+  IG+
Sbjct: 581 YASMVGESQIGM 592


>Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical
           protein K08F8.6 protein.
          Length = 2862

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +2

Query: 158 PRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTT 274
           P+G+P+IEV  D + +  + +  +    N + +S LP T
Sbjct: 672 PKGIPEIEVDKDFELHNDIKIPKVPNDDNYKPKSFLPIT 710


>AF070920-1|AAC24231.1|  554|Caenorhabditis elegans cytoplasmic
           signalling transducer protein.
          Length = 554

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 173 QIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQ 352
           ++E T ++   G     A+     +     L TT  +SP      WL R+R  E+ MT  
Sbjct: 410 RVEATTEVTYVGSPAPHALAARVGRNIPHRLETT-TLSPVAHDQTWLRRRRDCESPMTND 468

Query: 353 KETIQGQECIGI 388
             ++ G+  IG+
Sbjct: 469 YASMVGESQIGM 480


>AF063244-1|AAC16434.1|  666|Caenorhabditis elegans cytoplasmic
           signalling transducer protein.
          Length = 666

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 173 QIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQ 352
           ++E T ++   G     A+     +     L TT  +SP      WL R+R  E+ MT  
Sbjct: 522 RVEATTEVTYVGSPAPHALAARVGRNIPHRLETT-TLSPVAHDQTWLRRRRDCESPMTND 580

Query: 353 KETIQGQECIGI 388
             ++ G+  IG+
Sbjct: 581 YASMVGESQIGM 592


>AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator complex
           subunit Med13 protein.
          Length = 2862

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +2

Query: 158 PRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTT 274
           P+G+P+IEV  D + +  + +  +    N + +S LP T
Sbjct: 672 PKGIPEIEVDKDFELHNDIKIPKVPNDDNYKPKSFLPIT 710


>Z81097-1|CAB03175.1|  491|Caenorhabditis elegans Hypothetical
           protein K07A1.2 protein.
          Length = 491

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 21/47 (44%), Positives = 24/47 (51%)
 Frame = -3

Query: 288 GETTFVVGNGDLFSLLVDFSIAETLRIPLASMSKVTSI*GTPRGAGG 148
           GE  F V  GD  + LV   IA      L + SKV S+  T RGAGG
Sbjct: 441 GENDFEVKKGDRIAQLVCEQIA------LCTYSKVESLEVTERGAGG 481


>Z78546-6|CAB54307.1|  642|Caenorhabditis elegans Hypothetical
           protein M03B6.3 protein.
          Length = 642

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
 Frame = -3

Query: 279 TFVVGNGDLFSLLVD-FSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSSNLPSKLLSLV 103
           T ++G G L  L+V+ F +A+ + +PL  +    +  GTP    G+  +S    K L   
Sbjct: 58  TNMLGGGMLSELVVNPFGVAKNIGVPLEDLGINKTDFGTPLDLPGMNGTSKAAFKFLDAF 117

Query: 102 IARSPS 85
            ++ P+
Sbjct: 118 TSQPPT 123


>Z78545-5|CAB01764.2|  642|Caenorhabditis elegans Hypothetical
           protein M03B6.3 protein.
          Length = 642

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
 Frame = -3

Query: 279 TFVVGNGDLFSLLVD-FSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSSNLPSKLLSLV 103
           T ++G G L  L+V+ F +A+ + +PL  +    +  GTP    G+  +S    K L   
Sbjct: 58  TNMLGGGMLSELVVNPFGVAKNIGVPLEDLGINKTDFGTPLDLPGMNGTSKAAFKFLDAF 117

Query: 102 IARSPS 85
            ++ P+
Sbjct: 118 TSQPPT 123


>Z72516-1|CAA96687.2|  156|Caenorhabditis elegans Hypothetical
           protein T25G3.1 protein.
          Length = 156

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKG 357
           Q+ + N+K  L+KEE+E+ + E +K   +   A+G
Sbjct: 74  QVVVLNEKTDLTKEELEKELEEKKKEEGDKLIAEG 108


>U96695-1|AAB57697.1|  491|Caenorhabditis elegans
           deoxyuridinetriphosphatase protein.
          Length = 491

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 21/47 (44%), Positives = 24/47 (51%)
 Frame = -3

Query: 288 GETTFVVGNGDLFSLLVDFSIAETLRIPLASMSKVTSI*GTPRGAGG 148
           GE  F V  GD  + LV   IA      L + SKV S+  T RGAGG
Sbjct: 441 GENDFEVKKGDRIAQLVCEQIA------LCTYSKVESLEVTERGAGG 481


>Z99281-44|CAJ76963.1|   96|Caenorhabditis elegans Hypothetical
           protein Y57G11C.52 protein.
          Length = 96

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +1

Query: 259 TITNDKGRLSKEEIERMVNEAEKYR 333
           T  N  G LSKEE++ M++E+ K R
Sbjct: 70  TCVNGLGCLSKEEVQMMIDESNKPR 94


>AF045645-3|AAC02610.2|  193|Caenorhabditis elegans Hypothetical
           protein K02D7.2 protein.
          Length = 193

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = +1

Query: 181 GHLRHRCQRYPQRFRYREVHQQGEQITITNDK-GRLSKEEIE 303
           G  +HRC R  Q F   +V Q+ EQ        G   KE++E
Sbjct: 148 GEKKHRCSRCGQSFARVQVRQRHEQCCRGGGSGGEAEKEDVE 189


>AF026208-2|AAB71269.3|  774|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 40
           protein.
          Length = 774

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 274 KGRLSKEEIERMVNEAEKYRNEDDKAKGD 360
           K +LSKEEI+ +V + E  +N +  AK D
Sbjct: 295 KSKLSKEEIDEIVAQVEGNKNIEKPAKYD 323


>AF024502-4|AAB70374.1|  675|Caenorhabditis elegans Hypothetical
           protein M151.2 protein.
          Length = 675

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 7/77 (9%)
 Frame = +1

Query: 151 TGAAWRASN*GHLRH----RCQRYPQRF---RYREVHQQGEQITITNDKGRLSKEEIERM 309
           +G  W +   G+LR      CQR  QR      +    Q EQI    ++GR   ++++ +
Sbjct: 55  SGEFWHSGTRGNLRQASSAECQRLLQRTDEAAKQSAAAQEEQIEKLAEQGRKKDDKLKEL 114

Query: 310 VNEAEKYRNEDDKAKGD 360
            N AE  + +  +   D
Sbjct: 115 ENNAEALKTQLQEQTND 131


>AF000263-12|AAO21392.1|  838|Caenorhabditis elegans Hypothetical
           protein T08B2.5f protein.
          Length = 838

 Score = 27.5 bits (58), Expect = 8.0
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +3

Query: 228 SRSPPTRRTDHHYQRQRSSLQGRDRAY 308
           SRSP  RRT    +  RSS + RDR++
Sbjct: 47  SRSPSRRRTSRDRRDDRSSRRRRDRSH 73


>AF000263-11|AAL77184.1|  866|Caenorhabditis elegans Hypothetical
           protein T08B2.5c protein.
          Length = 866

 Score = 27.5 bits (58), Expect = 8.0
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +3

Query: 228 SRSPPTRRTDHHYQRQRSSLQGRDRAY 308
           SRSP  RRT    +  RSS + RDR++
Sbjct: 75  SRSPSRRRTSRDRRDDRSSRRRRDRSH 101


>AF000263-8|AAK21461.1|  924|Caenorhabditis elegans Hypothetical
           protein T08B2.5a protein.
          Length = 924

 Score = 27.5 bits (58), Expect = 8.0
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +3

Query: 228 SRSPPTRRTDHHYQRQRSSLQGRDRAY 308
           SRSP  RRT    +  RSS + RDR++
Sbjct: 133 SRSPSRRRTSRDRRDDRSSRRRRDRSH 159


>AF000263-7|AAK21463.1|  925|Caenorhabditis elegans Hypothetical
           protein T08B2.5b protein.
          Length = 925

 Score = 27.5 bits (58), Expect = 8.0
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +3

Query: 228 SRSPPTRRTDHHYQRQRSSLQGRDRAY 308
           SRSP  RRT    +  RSS + RDR++
Sbjct: 134 SRSPSRRRTSRDRRDDRSSRRRRDRSH 160


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,908,210
Number of Sequences: 27780
Number of extensions: 328224
Number of successful extensions: 1266
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 1175
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1259
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1321669750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).