SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical ...    30   1.4  
U40941-5|AAA81710.1|  300|Caenorhabditis elegans Hypothetical pr...    30   1.9  
AL031635-5|CAA21042.1| 1113|Caenorhabditis elegans Hypothetical ...    30   1.9  
Z72510-6|CAM84693.1| 2892|Caenorhabditis elegans Hypothetical pr...    29   2.4  
Z72510-5|CAM84692.1| 3095|Caenorhabditis elegans Hypothetical pr...    29   2.4  
Z72507-18|CAM84805.1| 2892|Caenorhabditis elegans Hypothetical p...    29   2.4  
Z72507-17|CAM84804.1| 3095|Caenorhabditis elegans Hypothetical p...    29   2.4  
U58757-9|AAM75377.1|  503|Caenorhabditis elegans Hypothetical pr...    28   7.5  
U58757-8|AAC47918.3|  506|Caenorhabditis elegans Hypothetical pr...    28   7.5  
Z68751-3|CAA92973.1|  760|Caenorhabditis elegans Hypothetical pr...    27   9.9  
U41543-12|AAZ91345.1|  401|Caenorhabditis elegans Groundhog (hed...    27   9.9  

>AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical
           protein Y8A9A.2 protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETES 327
           ST  +T  S TES+ TS   T   +  ESTTE+ S
Sbjct: 189 STTTTTATSTTESTSTSTDSTTTESTTESTTESTS 223



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 20/62 (32%), Positives = 30/62 (48%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTTI 252
           +T  ST  S TES+ TS   T   +  ESTTE+ S    S    + ++   +  +  TT 
Sbjct: 209 TTTESTTESTTESTSTSTDSTTTESTTESTTESTSTSTDSTTTESTSTSTDSTTTESTTE 268

Query: 251 AT 246
           +T
Sbjct: 269 ST 270



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETES 327
           ST  ST  + TES+ TS   T   +  ESTTE+ S
Sbjct: 241 STSTSTDSTTTESTSTSTDSTTTESTTESTTESTS 275


>U40941-5|AAA81710.1|  300|Caenorhabditis elegans Hypothetical
           protein F35C8.5 protein.
          Length = 300

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 4/60 (6%)
 Frame = +2

Query: 122 WYSPVWLWPMAALNLQW--DTATPL--PEVTQEASALPLSAADTELLLWWSFWIPRWPFW 289
           W   +W++PMA + L W  DT  P+  P V +  S L +     +   +W  +I     W
Sbjct: 98  WNQLLWIYPMALVQLIWVPDTELPILAPTVFEMLSQLAIFFLAFDFTYFWFHYINHKVKW 157


>AL031635-5|CAA21042.1| 1113|Caenorhabditis elegans Hypothetical
           protein Y47D3B.7 protein.
          Length = 1113

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)
 Frame = +3

Query: 471 PEPVEQRLPRIPGV--APPQKHYKIIFIKGPNSSHSYCPHNS 590
           P P +Q  P IPG   +PPQ++Y I   +  ++ HS   HN+
Sbjct: 45  PGPSQQPDPSIPGNQHSPPQEYYDIDGQRDVSTLHSLLNHNN 86


>Z72510-6|CAM84693.1| 2892|Caenorhabditis elegans Hypothetical
           protein F53B7.5b protein.
          Length = 2892

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTT 255
           +T  ++    +E++  + A TAA    ES T TES   V+  +G+A +  AT    +TT
Sbjct: 182 ATTAASTTKDSETTTEASATTAATTTQESITTTES-DSVTTTEGSATTGAATTKDSVTT 239


>Z72510-5|CAM84692.1| 3095|Caenorhabditis elegans Hypothetical
           protein F53B7.5a protein.
          Length = 3095

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTT 255
           +T  ++    +E++  + A TAA    ES T TES   V+  +G+A +  AT    +TT
Sbjct: 182 ATTAASTTKDSETTTEASATTAATTTQESITTTES-DSVTTTEGSATTGAATTKDSVTT 239


>Z72507-18|CAM84805.1| 2892|Caenorhabditis elegans Hypothetical
           protein F53B7.5b protein.
          Length = 2892

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTT 255
           +T  ++    +E++  + A TAA    ES T TES   V+  +G+A +  AT    +TT
Sbjct: 182 ATTAASTTKDSETTTEASATTAATTTQESITTTES-DSVTTTEGSATTGAATTKDSVTT 239


>Z72507-17|CAM84804.1| 3095|Caenorhabditis elegans Hypothetical
           protein F53B7.5a protein.
          Length = 3095

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTT 255
           +T  ++    +E++  + A TAA    ES T TES   V+  +G+A +  AT    +TT
Sbjct: 182 ATTAASTTKDSETTTEASATTAATTTQESITTTES-DSVTTTEGSATTGAATTKDSVTT 239


>U58757-9|AAM75377.1|  503|Caenorhabditis elegans Hypothetical
           protein C01B10.6b protein.
          Length = 503

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT 276
           +T  SAT S++TS+  +++A  G ST  T++ +  S+   +  S  +T
Sbjct: 457 ATGSSATGSTVTSDVASSSATGGSSTNATDTTQ--SSTDASTVSTSST 502


>U58757-8|AAC47918.3|  506|Caenorhabditis elegans Hypothetical
           protein C01B10.6a protein.
          Length = 506

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT 276
           +T  SAT S++TS+  +++A  G ST  T++ +  S+   +  S  +T
Sbjct: 460 ATGSSATGSTVTSDVASSSATGGSSTNATDTTQ--SSTDASTVSTSST 505


>Z68751-3|CAA92973.1|  760|Caenorhabditis elegans Hypothetical
           protein T05E11.3 protein.
          Length = 760

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 13/58 (22%), Positives = 29/58 (50%)
 Frame = -3

Query: 503 DTRKSLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETE 330
           DT K+L++ +  +++N D+FL++  T +       E + T +       + + T + E
Sbjct: 250 DTLKNLVHKY-SQFINFDIFLWQSKTEMVEEAVEEEPATTEDGAVEEEKEEKKTKKVE 306


>U41543-12|AAZ91345.1|  401|Caenorhabditis elegans Groundhog
           (hedgehog-like family)protein 7 protein.
          Length = 401

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 13/44 (29%), Positives = 17/44 (38%)
 Frame = +3

Query: 465 PPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYP 596
           PPP P       +P  APP   Y    +  P    +  P N+ P
Sbjct: 50  PPPPPAPYPQQAVPAPAPPPAPYPQHAVPAPAPPLASYPQNAVP 93


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,554,626
Number of Sequences: 27780
Number of extensions: 210267
Number of successful extensions: 915
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 850
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 911
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1634564590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).