SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D10877-1|BAA01645.1|  346|Caenorhabditis elegans hnRNP like prot...   103   1e-22
AF038613-8|AAL02515.2|  309|Caenorhabditis elegans Human hnrnp a...   103   1e-22
AF038613-7|ABB51185.1|  308|Caenorhabditis elegans Human hnrnp a...   103   1e-22
AF038613-6|ABB51186.1|  347|Caenorhabditis elegans Human hnrnp a...   103   1e-22
AF038613-5|AAB92051.1|  346|Caenorhabditis elegans Human hnrnp a...   103   1e-22
AF098501-6|AAL38960.1|  315|Caenorhabditis elegans Hypothetical ...    80   1e-15
AF098501-5|AAM69104.1|  335|Caenorhabditis elegans Hypothetical ...    80   1e-15
AF098501-4|AAL38959.1|  336|Caenorhabditis elegans Hypothetical ...    80   1e-15
Z35601-1|CAA84667.2|  320|Caenorhabditis elegans Hypothetical pr...    76   3e-14
AB036738-1|BAB13470.1|  320|Caenorhabditis elegans neural RNA-bi...    76   3e-14
AF047662-1|AAC04442.1|  248|Caenorhabditis elegans Suppressor pr...    49   4e-06
Z83230-6|CAB05746.1|  336|Caenorhabditis elegans Hypothetical pr...    48   7e-06
Z81108-4|CAB03237.1|   85|Caenorhabditis elegans Hypothetical pr...    47   2e-05
Z81108-1|CAB03236.1|   83|Caenorhabditis elegans Hypothetical pr...    46   4e-05
AL117204-22|CAB55151.1|  331|Caenorhabditis elegans Hypothetical...    45   7e-05
AC084197-11|AAM44397.1|  305|Caenorhabditis elegans Homologous t...    44   9e-05
AC084197-10|AAY43984.1|  308|Caenorhabditis elegans Homologous t...    44   9e-05
Z81106-3|CAB03222.1|   84|Caenorhabditis elegans Hypothetical pr...    44   2e-04
U28944-7|AAN63457.1|  295|Caenorhabditis elegans Hypothetical pr...    43   2e-04
U28944-6|AAN63456.1|  305|Caenorhabditis elegans Hypothetical pr...    43   2e-04
U28944-5|AAK68191.1|  408|Caenorhabditis elegans Hypothetical pr...    43   2e-04
U28944-4|AAK68192.1|  376|Caenorhabditis elegans Hypothetical pr...    43   2e-04
Z77654-1|CAB01127.1|  114|Caenorhabditis elegans Hypothetical pr...    43   3e-04
Z50110-2|CAA90446.1|  566|Caenorhabditis elegans Hypothetical pr...    42   5e-04
Z50110-1|CAA90444.1|  692|Caenorhabditis elegans Hypothetical pr...    42   5e-04
U24123-1|AAA65224.1|  646|Caenorhabditis elegans polyadenylate-b...    40   0.001
AL032631-4|CAE54917.1|  586|Caenorhabditis elegans Hypothetical ...    40   0.001
AL032631-3|CAE54916.1|  583|Caenorhabditis elegans Hypothetical ...    40   0.001
AL032631-2|CAA21572.1|  646|Caenorhabditis elegans Hypothetical ...    40   0.001
AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical...    40   0.002
AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical ...    40   0.002
Z50874-3|CAA90773.1|  409|Caenorhabditis elegans Hypothetical pr...    40   0.003
Z50874-2|CAA90772.1|  357|Caenorhabditis elegans Hypothetical pr...    40   0.003
Z36752-6|CAA85327.1|  456|Caenorhabditis elegans Hypothetical pr...    38   0.006
AL110485-8|CAB60356.1|  434|Caenorhabditis elegans Hypothetical ...    38   0.006
U23450-2|AAK31468.1|  302|Caenorhabditis elegans Hypothetical pr...    38   0.008
U23484-11|AAC46764.2|  191|Caenorhabditis elegans Hypothetical p...    37   0.014
Z92826-4|CAB07322.1|  309|Caenorhabditis elegans Hypothetical pr...    37   0.018
Z81473-3|CAB03896.4|  514|Caenorhabditis elegans Hypothetical pr...    37   0.018
U23484-10|AAC46772.1|  197|Caenorhabditis elegans Hypothetical p...    37   0.018
AY342388-1|AAQ19851.1|  514|Caenorhabditis elegans putative RNA-...    37   0.018
U80455-1|AAB37881.1|  584|Caenorhabditis elegans Elav-type rna b...    36   0.024
U55363-5|AAA97963.1|  351|Caenorhabditis elegans Spindle orienta...    36   0.024
U53931-1|AAA98566.1|  584|Caenorhabditis elegans elav-type ribon...    36   0.024
U23484-3|AAK68298.1|  126|Caenorhabditis elegans Sr protein (spl...    36   0.024
U23484-2|AAC46767.1|  196|Caenorhabditis elegans Sr protein (spl...    36   0.024
EF523770-1|ABS18836.1|  513|Caenorhabditis elegans ELAV-type RNA...    36   0.024
EF523769-1|ABS18835.1|  327|Caenorhabditis elegans ELAV-type RNA...    36   0.024
EF523768-1|ABS18834.1|  378|Caenorhabditis elegans ELAV-type RNA...    36   0.024
EF523766-1|ABS18832.1|  584|Caenorhabditis elegans ELAV-type RNA...    36   0.024
AB052819-1|BAC65239.1|  351|Caenorhabditis elegans PIP-1 protein.      36   0.024
Z35663-4|CAA84724.1|  307|Caenorhabditis elegans Hypothetical pr...    36   0.032
U21320-5|AAA62536.2|  332|Caenorhabditis elegans Rnp (rrm rna bi...    36   0.042
AF038623-4|AAO91699.1|  177|Caenorhabditis elegans Hypothetical ...    35   0.055
Z78536-3|CAB01717.2|  360|Caenorhabditis elegans Hypothetical pr...    35   0.073
Z49910-5|CAA90120.1|  411|Caenorhabditis elegans Hypothetical pr...    35   0.073
Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical pr...    34   0.096
Z68297-5|CAC70081.1|  394|Caenorhabditis elegans Hypothetical pr...    34   0.13 
AF003145-3|AAB57717.1|  751|Caenorhabditis elegans Cpeb polya bi...    33   0.22 
U00052-10|AAK21429.2|  289|Caenorhabditis elegans Rnp (rrm rna b...    33   0.29 
EF523767-1|ABS18833.1|  193|Caenorhabditis elegans ELAV-type RNA...    33   0.29 
Z46676-8|CAB60993.2|  388|Caenorhabditis elegans Hypothetical pr...    32   0.51 
U24189-3|AAC47514.1|  398|Caenorhabditis elegans RRM-type RNA bi...    32   0.51 
Z97628-2|CAB10726.2|  427|Caenorhabditis elegans Hypothetical pr...    31   0.68 
Z81080-5|CAB03088.2|  427|Caenorhabditis elegans Hypothetical pr...    31   0.68 
Z81080-2|CAD56584.1|  358|Caenorhabditis elegans Hypothetical pr...    31   0.68 
U80455-2|AAB37882.2|  420|Caenorhabditis elegans Elav-type rna b...    31   0.68 
AC024791-23|AAM81102.1|  346|Caenorhabditis elegans Rnp (rrm rna...    31   0.68 
AC024791-22|AAF60676.1|  339|Caenorhabditis elegans Rnp (rrm rna...    31   0.68 
AC024791-21|AAF60666.1|  749|Caenorhabditis elegans Rnp (rrm rna...    31   0.68 
Z74031-14|CAD66220.1|  187|Caenorhabditis elegans Hypothetical p...    31   0.90 
Z36238-4|CAD82915.1|  286|Caenorhabditis elegans Hypothetical pr...    31   1.2  
Z36238-3|CAA85276.1|  404|Caenorhabditis elegans Hypothetical pr...    31   1.2  
DQ485531-1|ABF22491.1|  404|Caenorhabditis elegans RNA-binding p...    31   1.2  
U23450-1|AAK31467.2|  422|Caenorhabditis elegans Cpeb polya bind...    30   1.6  
U80436-5|AAT68892.1| 2140|Caenorhabditis elegans Uncoordinated p...    30   2.1  
U80436-4|AAC71111.1|  552|Caenorhabditis elegans Uncoordinated p...    30   2.1  
U80436-3|AAL06029.3|  633|Caenorhabditis elegans Uncoordinated p...    30   2.1  
U80436-2|AAC71110.1|  928|Caenorhabditis elegans Uncoordinated p...    30   2.1  
U80436-1|AAC71108.1| 2488|Caenorhabditis elegans Uncoordinated p...    30   2.1  
AF048834-1|AAC12931.1| 2488|Caenorhabditis elegans guanine nucle...    30   2.1  
AL137227-1|CAB70238.2|  611|Caenorhabditis elegans Hypothetical ...    29   2.7  
Z81037-3|CAB02750.1|  205|Caenorhabditis elegans Hypothetical pr...    29   3.6  
U41531-7|AAA83161.2|  415|Caenorhabditis elegans Feminizing gene...    29   3.6  
U14946-1|AAA67723.1|  415|Caenorhabditis elegans ribonucleoprote...    29   3.6  
AF098993-1|AAC67471.2|  367|Caenorhabditis elegans Zinc finger t...    29   3.6  
Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical pr...    28   6.3  
U50193-8|AAL11478.2|  394|Caenorhabditis elegans Hypothetical pr...    28   8.4  
AC087081-13|AAK66033.1|  253|Caenorhabditis elegans Hypothetical...    28   8.4  
U97407-6|AAB52481.1|  751|Caenorhabditis elegans Tyrosinase prot...    25   8.9  

>D10877-1|BAA01645.1|  346|Caenorhabditis elegans hnRNP like protein
           protein.
          Length = 346

 Score =  103 bits (247), Expect = 1e-22
 Identities = 44/85 (51%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D++VM+DP TKRS+GFGF+T+S    VD A   RPH IDG+ V+PKRAVPR++  
Sbjct: 46  FGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN 105

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R E++ + K+L+V+G+++D  E+ L
Sbjct: 106 RSESNVSTKRLYVSGVREDHTEDML 130



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    L EYF+ +G +    ++ DK T K RGFGFV FDD+D VD+  LQ++H +
Sbjct: 125 HTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMV 179



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +RE++S FG I  + V+ D  T + RGFGFV F     VD    Q+ H I
Sbjct: 39  MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHII 88



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = +1

Query: 154 SGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY-EHGE 261
           SGD   EPE+ RK+F+GGL   TTD  ++EFY + GE
Sbjct: 12  SGDASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGE 48



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 13/63 (20%), Positives = 35/63 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +    ++ D  T++ +GFGF+T+     VD+    + H ++G   + ++ + ++E+ 
Sbjct: 137 YGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMS 196

Query: 435 RPE 443
           + +
Sbjct: 197 KAQ 199


>AF038613-8|AAL02515.2|  309|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform b protein.
          Length = 309

 Score =  103 bits (247), Expect = 1e-22
 Identities = 44/85 (51%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D++VM+DP TKRS+GFGF+T+S    VD A   RPH IDG+ V+PKRAVPR++  
Sbjct: 8   FGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN 67

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R E++ + K+L+V+G+++D  E+ L
Sbjct: 68  RSESNVSTKRLYVSGVREDHTEDML 92



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    L EYF+ +G +    ++ DK T K RGFGFV FDD+D VD+  LQ++H +
Sbjct: 87  HTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMV 141



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +RE++S FG I  + V+ D  T + RGFGFV F     VD    Q+ H I
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHII 50



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 13/63 (20%), Positives = 35/63 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +    ++ D  T++ +GFGF+T+     VD+    + H ++G   + ++ + ++E+ 
Sbjct: 99  YGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMS 158

Query: 435 RPE 443
           + +
Sbjct: 159 KAQ 161


>AF038613-7|ABB51185.1|  308|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform c protein.
          Length = 308

 Score =  103 bits (247), Expect = 1e-22
 Identities = 44/85 (51%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D++VM+DP TKRS+GFGF+T+S    VD A   RPH IDG+ V+PKRAVPR++  
Sbjct: 8   FGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN 67

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R E++ + K+L+V+G+++D  E+ L
Sbjct: 68  RSESNVSTKRLYVSGVREDHTEDML 92



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    L EYF+ +G +    ++ DK T K RGFGFV FDD+D VD+  LQ++H +
Sbjct: 87  HTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMV 141



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +RE++S FG I  + V+ D  T + RGFGFV F     VD    Q+ H I
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHII 50



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 13/63 (20%), Positives = 35/63 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +    ++ D  T++ +GFGF+T+     VD+    + H ++G   + ++ + ++E+ 
Sbjct: 99  YGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMS 158

Query: 435 RPE 443
           + +
Sbjct: 159 KAQ 161


>AF038613-6|ABB51186.1|  347|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform d protein.
          Length = 347

 Score =  103 bits (247), Expect = 1e-22
 Identities = 44/85 (51%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D++VM+DP TKRS+GFGF+T+S    VD A   RPH IDG+ V+PKRAVPR++  
Sbjct: 46  FGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN 105

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R E++ + K+L+V+G+++D  E+ L
Sbjct: 106 RSESNVSTKRLYVSGVREDHTEDML 130



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    L EYF+ +G +    ++ DK T K RGFGFV FDD+D VD+  LQ++H +
Sbjct: 125 HTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMV 179



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +RE++S FG I  + V+ D  T + RGFGFV F     VD    Q+ H I
Sbjct: 39  MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHII 88



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = +1

Query: 154 SGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY-EHGE 261
           SGD   EPE+ RK+F+GGL   TTD  ++EFY + GE
Sbjct: 12  SGDASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGE 48



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 13/63 (20%), Positives = 35/63 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +    ++ D  T++ +GFGF+T+     VD+    + H ++G   + ++ + ++E+ 
Sbjct: 137 YGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMS 196

Query: 435 RPE 443
           + +
Sbjct: 197 KAQ 199


>AF038613-5|AAB92051.1|  346|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform a protein.
          Length = 346

 Score =  103 bits (247), Expect = 1e-22
 Identities = 44/85 (51%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D++VM+DP TKRS+GFGF+T+S    VD A   RPH IDG+ V+PKRAVPR++  
Sbjct: 46  FGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN 105

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R E++ + K+L+V+G+++D  E+ L
Sbjct: 106 RSESNVSTKRLYVSGVREDHTEDML 130



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    L EYF+ +G +    ++ DK T K RGFGFV FDD+D VD+  LQ++H +
Sbjct: 125 HTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMV 179



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +RE++S FG I  + V+ D  T + RGFGFV F     VD    Q+ H I
Sbjct: 39  MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHII 88



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = +1

Query: 154 SGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY-EHGE 261
           SGD   EPE+ RK+F+GGL   TTD  ++EFY + GE
Sbjct: 12  SGDASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGE 48



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 13/63 (20%), Positives = 35/63 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +    ++ D  T++ +GFGF+T+     VD+    + H ++G   + ++ + ++E+ 
Sbjct: 137 YGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMS 196

Query: 435 RPE 443
           + +
Sbjct: 197 KAQ 199


>AF098501-6|AAL38960.1|  315|Caenorhabditis elegans Hypothetical
           protein H28G03.1b protein.
          Length = 315

 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 29/59 (49%), Positives = 45/59 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           WG +VD +V++DP TK S+GFGF+T++     + A N+RPHK+ G+ V+ KRA+PRE++
Sbjct: 72  WGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKLGGKTVDSKRAIPREQM 130



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR YF TFG +  V ++     G+ RG GFV ++D +  DR CL  N
Sbjct: 164 LRVYFETFGTLDQVEIL-----GQPRGLGFVIYEDKESADR-CLAHN 204



 Score = 36.3 bits (80), Expect = 0.024
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +L  YFS +G +V   V+ D  T   RGFGFV F
Sbjct: 64  QLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTF 97



 Score = 33.5 bits (73), Expect = 0.17
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 166 YEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           ++ P   RKLFIGGL + TTD  L  ++
Sbjct: 42  HDSPPQLRKLFIGGLSHDTTDEQLGNYF 69


>AF098501-5|AAM69104.1|  335|Caenorhabditis elegans Hypothetical
           protein H28G03.1c protein.
          Length = 335

 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 29/59 (49%), Positives = 45/59 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           WG +VD +V++DP TK S+GFGF+T++     + A N+RPHK+ G+ V+ KRA+PRE++
Sbjct: 92  WGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKLGGKTVDSKRAIPREQM 150



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR YF TFG +  V ++     G+ RG GFV ++D +  DR CL  N
Sbjct: 184 LRVYFETFGTLDQVEIL-----GQPRGLGFVIYEDKESADR-CLAHN 224



 Score = 36.3 bits (80), Expect = 0.024
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +L  YFS +G +V   V+ D  T   RGFGFV F
Sbjct: 84  QLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTF 117



 Score = 33.5 bits (73), Expect = 0.17
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 166 YEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           ++ P   RKLFIGGL + TTD  L  ++
Sbjct: 62  HDSPPQLRKLFIGGLSHDTTDEQLGNYF 89


>AF098501-4|AAL38959.1|  336|Caenorhabditis elegans Hypothetical
           protein H28G03.1a protein.
          Length = 336

 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 29/59 (49%), Positives = 45/59 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           WG +VD +V++DP TK S+GFGF+T++     + A N+RPHK+ G+ V+ KRA+PRE++
Sbjct: 93  WGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKLGGKTVDSKRAIPREQM 151



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR YF TFG +  V ++     G+ RG GFV ++D +  DR CL  N
Sbjct: 185 LRVYFETFGTLDQVEIL-----GQPRGLGFVIYEDKESADR-CLAHN 225



 Score = 36.3 bits (80), Expect = 0.024
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +L  YFS +G +V   V+ D  T   RGFGFV F
Sbjct: 85  QLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTF 118



 Score = 33.5 bits (73), Expect = 0.17
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 166 YEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           ++ P   RKLFIGGL + TTD  L  ++
Sbjct: 63  HDSPPQLRKLFIGGLSHDTTDEQLGNYF 90


>Z35601-1|CAA84667.2|  320|Caenorhabditis elegans Hypothetical
           protein R10E9.1 protein.
          Length = 320

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 34/86 (39%), Positives = 55/86 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + +VM+DP TKR++GFGFIT+     VD+  NNR H++DG+ ++PK A P+    
Sbjct: 68  FGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKR--T 125

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           + +     KK+F+ GL      ED++
Sbjct: 126 QAKLVTKTKKVFIGGLSATSTLEDMK 151



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 22/64 (34%), Positives = 41/64 (64%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T+R +GFGF+T+    + D+      H+I+G++VE K+A
Sbjct: 150 MKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKA 209

Query: 414 VPRE 425
            P+E
Sbjct: 210 QPKE 213



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF T+G +    ++ DK T + RGFGFV FD  +  D+VC    H+I
Sbjct: 150 MKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEI 199



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  FG +    V+ D  T + RGFGF+ F D   VD+V   + H++
Sbjct: 61  LRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHEL 110



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = +1

Query: 148 SESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           ++S D     +   K+FIGGL ++TT  +L++++
Sbjct: 32  ADSDDGSHGSQDPGKMFIGGLSWQTTAENLRDYF 65


>AB036738-1|BAB13470.1|  320|Caenorhabditis elegans neural
           RNA-binding protein MSI-1 protein.
          Length = 320

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 34/86 (39%), Positives = 55/86 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + +VM+DP TKR++GFGFIT+     VD+  NNR H++DG+ ++PK A P+    
Sbjct: 68  FGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKR--T 125

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           + +     KK+F+ GL      ED++
Sbjct: 126 QAKLVTKTKKVFIGGLSATSTLEDMK 151



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 22/64 (34%), Positives = 41/64 (64%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T+R +GFGF+T+    + D+      H+I+G++VE K+A
Sbjct: 150 MKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKA 209

Query: 414 VPRE 425
            P+E
Sbjct: 210 QPKE 213



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF T+G +    ++ DK T + RGFGFV FD  +  D+VC    H+I
Sbjct: 150 MKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEI 199



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  FG +    V+ D  T + RGFGF+ F D   VD+V   + H++
Sbjct: 61  LRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHEL 110



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = +1

Query: 148 SESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           ++S D     +   K+FIGGL ++TT  +L++++
Sbjct: 32  ADSDDGSHGSQDPGKMFIGGLSWQTTAENLRDYF 65


>AF047662-1|AAC04442.1|  248|Caenorhabditis elegans Suppressor
           protein 12 protein.
          Length = 248

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 21/49 (42%), Positives = 27/49 (55%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           + L EYF  FG+I    V+TD+ T K RG+GFV   D    +R C   N
Sbjct: 49  KTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN 97



 Score = 35.9 bits (79), Expect = 0.032
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G+I + VV+ D  T++S+G+GF+T       + A  +    IDGR
Sbjct: 58  FGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGR 103



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 11/21 (52%), Positives = 17/21 (80%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y T+D +L E++E
Sbjct: 36  KIFVGGLPYHTSDKTLHEYFE 56


>Z83230-6|CAB05746.1|  336|Caenorhabditis elegans Hypothetical
           protein F56A8.6 protein.
          Length = 336

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 18/35 (51%), Positives = 27/35 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +R  FS  GN++S+ +V D+ETGK +G+GF+EF D
Sbjct: 34  IRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPD 68



 Score = 31.1 bits (67), Expect = 0.90
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIV 398
           I+ I    G ++ + ++ D +T + KG+GFI +      + A +N   +++ GRI+
Sbjct: 34  IRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYELSGRIL 89


>Z81108-4|CAB03237.1|   85|Caenorhabditis elegans Hypothetical
           protein R09B3.3 protein.
          Length = 85

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/47 (46%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L  YFS  GN+ +V +V D+ETG+ RGF FVEF +     R   Q N
Sbjct: 20  LGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQFN 66


>Z81108-1|CAB03236.1|   83|Caenorhabditis elegans Hypothetical
           protein R09B3.2 protein.
          Length = 83

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L  +FS+ G I +V +V D+ETG+ RGF F+EF +     R   Q N
Sbjct: 21  LGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQMN 67


>AL117204-22|CAB55151.1|  331|Caenorhabditis elegans Hypothetical
           protein Y116A8C.34 protein.
          Length = 331

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 18/30 (60%), Positives = 24/30 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           F  FG++V++S+  D E+GK RGFGFVEFD
Sbjct: 31  FIPFGDVVAISIPMDYESGKHRGFGFVEFD 60



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 14/64 (21%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEI 431
           +G++V + +  D ++ + +GFGF+ +  A     A  N    ++ G+ +    A P +  
Sbjct: 34  FGDVVAISIPMDYESGKHRGFGFVEFDMAEDAAMAIDNMNESELFGKTIRVNFARPPKAT 93

Query: 432 KRPE 443
           +R +
Sbjct: 94  ERSQ 97


>AC084197-11|AAM44397.1|  305|Caenorhabditis elegans Homologous to
           drosophila sqd (squid)protein protein 1, isoform a
           protein.
          Length = 305

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 30/87 (34%), Positives = 39/87 (44%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+    V  D    RS+GF F+ ++       A   R   I G+ VE K A  RE   
Sbjct: 52  YGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSREN-- 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                   KK+FV GL  D  E+DL S
Sbjct: 110 --------KKVFVGGLPSDYSEQDLRS 128



 Score = 35.5 bits (78), Expect = 0.042
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           LR +F  FG +  +    DK+T  +R F F+ F++ +  D+   Q
Sbjct: 126 LRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQ 170



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 19/71 (26%), Positives = 31/71 (43%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L  +F+ +G +    V  D+  G+ RGF FVEF   +        +   IK  ++ +   
Sbjct: 45  LSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPA 104

Query: 686 PISEN*HVWAG 718
              EN  V+ G
Sbjct: 105 KSRENKKVFVG 115



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 15/56 (26%), Positives = 28/56 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G++ D+    D +TK  + F FI + +    D+A +        R  + K+AVP+
Sbjct: 133 FGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188


>AC084197-10|AAY43984.1|  308|Caenorhabditis elegans Homologous to
           drosophila sqd (squid)protein protein 1, isoform b
           protein.
          Length = 308

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 30/87 (34%), Positives = 39/87 (44%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+    V  D    RS+GF F+ ++       A   R   I G+ VE K A  RE   
Sbjct: 52  YGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSREN-- 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                   KK+FV GL  D  E+DL S
Sbjct: 110 --------KKVFVGGLPSDYSEQDLRS 128



 Score = 35.5 bits (78), Expect = 0.042
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           LR +F  FG +  +    DK+T  +R F F+ F++ +  D+   Q
Sbjct: 126 LRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQ 170



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 19/71 (26%), Positives = 31/71 (43%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L  +F+ +G +    V  D+  G+ RGF FVEF   +        +   IK  ++ +   
Sbjct: 45  LSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPA 104

Query: 686 PISEN*HVWAG 718
              EN  V+ G
Sbjct: 105 KSRENKKVFVG 115



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 15/56 (26%), Positives = 28/56 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G++ D+    D +TK  + F FI + +    D+A +        R  + K+AVP+
Sbjct: 133 FGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188


>Z81106-3|CAB03222.1|   84|Caenorhabditis elegans Hypothetical
           protein R06C1.4 protein.
          Length = 84

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           YF+  G++ +V +V D+ETG+ RGF FVEF +     R   Q N
Sbjct: 25  YFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLN 68


>U28944-7|AAN63457.1|  295|Caenorhabditis elegans Hypothetical
           protein C18A3.5f protein.
          Length = 295

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++LRE F  FG++    V+ D  T K +G+GFV +   +  +R   Q N Q
Sbjct: 36  QKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQ 86



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G++ D  V++D  T +SKG+GF++Y +    + A
Sbjct: 45  FGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 79



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           +R+ F++FG I  V +       K +G+ FV+FD+ D   +  +Q N+Q
Sbjct: 143 IRQGFASFGRITEVRIF------KMQGYAFVKFDNKDAAAKAIVQMNNQ 185


>U28944-6|AAN63456.1|  305|Caenorhabditis elegans Hypothetical
           protein C18A3.5e protein.
          Length = 305

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++LRE F  FG++    V+ D  T K +G+GFV +   +  +R   Q N Q
Sbjct: 46  QKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQ 96



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G++ D  V++D  T +SKG+GF++Y +    + A
Sbjct: 55  FGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 89



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           +R+ F++FG I  V +       K +G+ FV+FD+ D   +  +Q N+Q
Sbjct: 153 IRQGFASFGRITEVRIF------KMQGYAFVKFDNKDAAAKAIVQMNNQ 195


>U28944-5|AAK68191.1|  408|Caenorhabditis elegans Hypothetical
           protein C18A3.5a protein.
          Length = 408

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++LRE F  FG++    V+ D  T K +G+GFV +   +  +R   Q N Q
Sbjct: 149 QKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQ 199



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G++ D  V++D  T +SKG+GF++Y +    + A
Sbjct: 158 FGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 192



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           +R+ F++FG I  V +       K +G+ FV+FD+ D   +  +Q N+Q
Sbjct: 256 IRQGFASFGRITEVRIF------KMQGYAFVKFDNKDAAAKAIVQMNNQ 298


>U28944-4|AAK68192.1|  376|Caenorhabditis elegans Hypothetical
           protein C18A3.5b protein.
          Length = 376

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++LRE F  FG++    V+ D  T K +G+GFV +   +  +R   Q N Q
Sbjct: 117 QKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQ 167



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G++ D  V++D  T +SKG+GF++Y +    + A
Sbjct: 126 FGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 160



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           +R+ F++FG I  V +       K +G+ FV+FD+ D   +  +Q N+Q
Sbjct: 224 IRQGFASFGRITEVRIF------KMQGYAFVKFDNKDAAAKAIVQMNNQ 266


>Z77654-1|CAB01127.1|  114|Caenorhabditis elegans Hypothetical
           protein C50B8.1 protein.
          Length = 114

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + +L  YF  +G+I SV++  D +TG  RGF  + FD  D  ++   Q+ H I
Sbjct: 38  KSQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIEQRPHVI 90



 Score = 37.9 bits (84), Expect = 0.008
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVP 419
           +G I  V +  DP T   +GF  IT+      ++A   RPH IDG  V+ +  +P
Sbjct: 48  YGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIEQRPHVIDGDRVDVEPYIP 102


>Z50110-2|CAA90446.1|  566|Caenorhabditis elegans Hypothetical
           protein F18H3.3b protein.
          Length = 566

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 22/53 (41%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + +L   FS FG I S  V+TD + GK +GFGFV F D D   +   + N  I
Sbjct: 251 QEKLSAMFSKFGEITSAVVMTDAQ-GKPKGFGFVAFADQDAAGQAVEKLNDSI 302



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/34 (52%), Positives = 25/34 (73%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR++FS+FG I S  V+ D E G+ +GFGFV F+
Sbjct: 359 LRDHFSSFGTITSAKVMVD-ENGRSKGFGFVCFE 391


>Z50110-1|CAA90444.1|  692|Caenorhabditis elegans Hypothetical
           protein F18H3.3a protein.
          Length = 692

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 22/53 (41%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + +L   FS FG I S  V+TD + GK +GFGFV F D D   +   + N  I
Sbjct: 251 QEKLSAMFSKFGEITSAVVMTDAQ-GKPKGFGFVAFADQDAAGQAVEKLNDSI 302



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/34 (52%), Positives = 25/34 (73%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR++FS+FG I S  V+ D E G+ +GFGFV F+
Sbjct: 359 LRDHFSSFGTITSAKVMVD-ENGRSKGFGFVCFE 391


>U24123-1|AAA65224.1|  646|Caenorhabditis elegans
           polyadenylate-binding protein protein.
          Length = 646

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++ F ++GNI S  V+TD E G+ +GFGFV F+  +       + N ++
Sbjct: 333 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKM 381



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +  L + F+ FGNI S  V+T +  GK +GFGFV F
Sbjct: 226 KETLEKVFAKFGNITSCEVMTVE--GKSKGFGFVAF 259



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQ 338
           +K+   ++G I    VM D +  RSKGFGF+ + +
Sbjct: 333 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEK 366


>AL032631-4|CAE54917.1|  586|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2c protein.
          Length = 586

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++ F ++GNI S  V+TD E G+ +GFGFV F+  +       + N ++
Sbjct: 273 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKM 321



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +  L + F+ FGNI S  V+T +  GK +GFGFV F
Sbjct: 166 KETLEKLFAKFGNITSCEVMTVE--GKSKGFGFVAF 199



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQ 338
           +K+   ++G I    VM D +  RSKGFGF+ + +
Sbjct: 273 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEK 306


>AL032631-3|CAE54916.1|  583|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2b protein.
          Length = 583

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++ F ++GNI S  V+TD E G+ +GFGFV F+  +       + N ++
Sbjct: 270 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKM 318



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +  L + F+ FGNI S  V+T +  GK +GFGFV F
Sbjct: 163 KETLEKLFAKFGNITSCEVMTVE--GKSKGFGFVAF 196



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQ 338
           +K+   ++G I    VM D +  RSKGFGF+ + +
Sbjct: 270 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEK 303


>AL032631-2|CAA21572.1|  646|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2a protein.
          Length = 646

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++ F ++GNI S  V+TD E G+ +GFGFV F+  +       + N ++
Sbjct: 333 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKM 381



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +  L + F+ FGNI S  V+T +  GK +GFGFV F
Sbjct: 226 KETLEKLFAKFGNITSCEVMTVE--GKSKGFGFVAF 259



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQ 338
           +K+   ++G I    VM D +  RSKGFGF+ + +
Sbjct: 333 LKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEK 366


>AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3c protein.
          Length = 435

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           R L E+FS  G +  V ++TD  TG+ +G  +VEF D + V
Sbjct: 39  RDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESV 79


>AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3a protein.
          Length = 580

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           R L E+FS  G +  V ++TD  TG+ +G  +VEF D + V
Sbjct: 184 RDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESV 224


>Z50874-3|CAA90773.1|  409|Caenorhabditis elegans Hypothetical
           protein R10E4.2b protein.
          Length = 409

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LRE  S +GNI S   + DK T   +G+GFV+F+
Sbjct: 123 LREMCSKYGNIASTKAIMDKATNNCKGYGFVDFE 156



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 22/87 (25%), Positives = 37/87 (42%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I     + D  T   KG+GF+ +        A       +DG   E  +A    +++
Sbjct: 130 YGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAA-------VDGLNTEGVQA-QMAKLQ 181

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           + E   T   L++A L  D  E+ LE+
Sbjct: 182 QQEQDPT--NLYIANLPLDFTEQMLET 206


>Z50874-2|CAA90772.1|  357|Caenorhabditis elegans Hypothetical
           protein R10E4.2a protein.
          Length = 357

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LRE  S +GNI S   + DK T   +G+GFV+F+
Sbjct: 97  LREMCSKYGNIASTKAIMDKATNNCKGYGFVDFE 130



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 22/87 (25%), Positives = 37/87 (42%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I     + D  T   KG+GF+ +        A       +DG   E  +A    +++
Sbjct: 104 YGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAA-------VDGLNTEGVQA-QMAKLQ 155

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           + E   T   L++A L  D  E+ LE+
Sbjct: 156 QQEQDPT--NLYIANLPLDFTEQMLET 180


>Z36752-6|CAA85327.1|  456|Caenorhabditis elegans Hypothetical
           protein F35H8.5 protein.
          Length = 456

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L   F  FG I++  +++D  TG  +G GFV FD  D  D
Sbjct: 144 LESIFRPFGQIITSRILSDNVTGLSKGVGFVRFDKKDEAD 183



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +  +R  F++ G I S  +V DK TG+  G+GFV +
Sbjct: 55  QEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNY 90


>AL110485-8|CAB60356.1|  434|Caenorhabditis elegans Hypothetical
           protein Y46G5A.13 protein.
          Length = 434

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +LRE F  FG +    ++ D  T K +G+GFV +   +  +R   + N
Sbjct: 147 KLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERAIDEMN 194



 Score = 31.9 bits (69), Expect = 0.51
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +GE+ +  +++D  T + KG+GF++Y +    + A
Sbjct: 155 FGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERA 189


>U23450-2|AAK31468.1|  302|Caenorhabditis elegans Hypothetical
           protein C30B5.4 protein.
          Length = 302

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 12/31 (38%), Positives = 24/31 (77%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G +++++++ DK+TGK +GF F+ + D
Sbjct: 58  FSQYGEVMNINLIRDKDTGKSKGFAFLCYKD 88



 Score = 31.1 bits (67), Expect = 0.90
 Identities = 12/38 (31%), Positives = 23/38 (60%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 368
           +GE++++ +++D  T +SKGF F+ Y        A +N
Sbjct: 61  YGEVMNINLIRDKDTGKSKGFAFLCYKDQRSTILAVDN 98


>U23484-11|AAC46764.2|  191|Caenorhabditis elegans Hypothetical
           protein EEED8.4 protein.
          Length = 191

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           + E+F   G IV  ++  DK T K++ F ++EFDD   ++
Sbjct: 71  IEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIEFDDSSSIE 110



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G+IV   + KD  TK+ K F +I +  +  ++ A
Sbjct: 79  GQIVKTTIPKDKFTKKQKNFAYIEFDDSSSIENA 112


>Z92826-4|CAB07322.1|  309|Caenorhabditis elegans Hypothetical
           protein C18D11.4 protein.
          Length = 309

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR+ F  FG I    +V D+ +G  RGFGF+ F+
Sbjct: 92  LRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFN 125


>Z81473-3|CAB03896.4|  514|Caenorhabditis elegans Hypothetical
           protein C17D12.2 protein.
          Length = 514

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD-YDPVDRVCLQQNHQI--KRFNIWM 676
           L + F+ FG+IVS  V  D+ T + + FGFV +D+ +     +      QI  KR  + +
Sbjct: 445 LIQMFAPFGHIVSAKVFVDRATNQSKCFGFVSYDNIHSSQAAITAMNGFQIGMKRLKVQL 504

Query: 677 *KKPISEN 700
            K+P +E+
Sbjct: 505 -KRPRNES 511



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 5/95 (5%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDG--RIVE 401
           ++ +   +G+I +  ++KD  T   KG  F+TY         Q   +    + G  R ++
Sbjct: 45  LRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQ 104

Query: 402 PKRAVPREEIKRPEASATVKKLFVAGL-KQDIEEE 503
            K A        P+     KKLF+  L KQ  E+E
Sbjct: 105 VKPADTDSRPASPKDKMDDKKLFIGMLSKQQSEDE 139


>U23484-10|AAC46772.1|  197|Caenorhabditis elegans Hypothetical
           protein EEED8.12 protein.
          Length = 197

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 14/40 (35%), Positives = 25/40 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           + E+F   G+IV  ++  DK T K++ F ++EFDD   ++
Sbjct: 77  VEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDDSSSIE 116


>AY342388-1|AAQ19851.1|  514|Caenorhabditis elegans putative
           RNA-binding protein protein.
          Length = 514

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD-YDPVDRVCLQQNHQI--KRFNIWM 676
           L + F+ FG+IVS  V  D+ T + + FGFV +D+ +     +      QI  KR  + +
Sbjct: 445 LIQMFAPFGHIVSAKVFVDRATNQSKCFGFVSYDNIHSSQAAITAMNGFQIGMKRLKVQL 504

Query: 677 *KKPISEN 700
            K+P +E+
Sbjct: 505 -KRPRNES 511



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 5/95 (5%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDG--RIVE 401
           ++ +   +G+I +  ++KD  T   KG  F+TY         Q   +    + G  R ++
Sbjct: 45  LRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQ 104

Query: 402 PKRAVPREEIKRPEASATVKKLFVAGL-KQDIEEE 503
            K A        P+     KKLF+  L KQ  E+E
Sbjct: 105 VKPADTDSRPASPKDKMDDKKLFIGMLSKQQSEDE 139


>U80455-1|AAB37881.1|  584|Caenorhabditis elegans Elav-type rna
           binding protein familyprotein 1, isoform a protein.
          Length = 584

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 488 RH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +H    LRE F+ FG+I   SV+ D++ GK RG  FV F
Sbjct: 152 KHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTF 189



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRA 413
           +R+   +G +    +++D  T+ SKG  F+T+       EAQ    + K+   +  P + 
Sbjct: 72  RRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQM 131

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P +   R E     +KLF+  L +   EE+L
Sbjct: 132 KPADTENRNE-----RKLFIGQLSKKHNEENL 158



 Score = 31.5 bits (68), Expect = 0.68
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           F+ FG I+S  V  DK T   + FGFV +++
Sbjct: 519 FAPFGGILSAKVFIDKVTNLSKCFGFVSYEN 549


>U55363-5|AAA97963.1|  351|Caenorhabditis elegans Spindle
           orientation defective protein4 protein.
          Length = 351

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVP--R 422
           A+G ++ V ++ + +   SKGFGF+T       ++A+       + GRI+E +RA P  R
Sbjct: 73  AYGRVLSVEIVTNDRG--SKGFGFVTLDSIESCEKARAALHESHVQGRIIEVRRATPTRR 130

Query: 423 EEIKRPE 443
           + I  P+
Sbjct: 131 KLINNPQ 137


>U53931-1|AAA98566.1|  584|Caenorhabditis elegans elav-type
           ribonucleoprotein protein.
          Length = 584

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 488 RH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +H    LRE F+ FG+I   SV+ D++ GK RG  FV F
Sbjct: 152 KHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTF 189



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRA 413
           +R+   +G +    +++D  T+ SKG  F+T+       EAQ    + K+   +  P + 
Sbjct: 72  RRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQM 131

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P +   R E     +KLF+  L +   EE+L
Sbjct: 132 KPADTENRNE-----RKLFIGQLSKKHNEENL 158



 Score = 31.5 bits (68), Expect = 0.68
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           F+ FG I+S  V  DK T   + FGFV +++
Sbjct: 519 FAPFGGILSAKVFIDKVTNLSKCFGFVSYEN 549


>U23484-3|AAK68298.1|  126|Caenorhabditis elegans Sr protein
           (splicing factor) protein4, isoform b protein.
          Length = 126

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGR 392
           ++R    +G+I DV + +D  +++SKGFGF+ + +    + A +    K +DGR
Sbjct: 35  LRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLVDGR 88



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR  F  +G+I  V +  DK + + +GFGFV F
Sbjct: 35  LRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRF 67


>U23484-2|AAC46767.1|  196|Caenorhabditis elegans Sr protein
           (splicing factor) protein4, isoform a protein.
          Length = 196

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGR 392
           ++R    +G+I DV + +D  +++SKGFGF+ + +    + A +    K +DGR
Sbjct: 35  LRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLVDGR 88



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR  F  +G+I  V +  DK + + +GFGFV F
Sbjct: 35  LRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRF 67


>EF523770-1|ABS18836.1|  513|Caenorhabditis elegans ELAV-type RNA
           binding protein variantE protein.
          Length = 513

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 488 RH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +H    LRE F+ FG+I   SV+ D++ GK RG  FV F
Sbjct: 152 KHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTF 189



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRA 413
           +R+   +G +    +++D  T+ SKG  F+T+       EAQ    + K+   +  P + 
Sbjct: 72  RRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQM 131

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P +   R E     +KLF+  L +   EE+L
Sbjct: 132 KPADTENRNE-----RKLFIGQLSKKHNEENL 158



 Score = 31.5 bits (68), Expect = 0.68
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           F+ FG I+S  V  DK T   + FGFV +++
Sbjct: 448 FAPFGGILSAKVFIDKVTNLSKCFGFVSYEN 478


>EF523769-1|ABS18835.1|  327|Caenorhabditis elegans ELAV-type RNA
           binding protein variantD protein.
          Length = 327

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 488 RH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +H    LRE F+ FG+I   SV+ D++ GK RG  FV F
Sbjct: 152 KHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTF 189



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRA 413
           +R+   +G +    +++D  T+ SKG  F+T+       EAQ    + K+   +  P + 
Sbjct: 72  RRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQM 131

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P +   R E     +KLF+  L +   EE+L
Sbjct: 132 KPADTENRNE-----RKLFIGQLSKKHNEENL 158


>EF523768-1|ABS18834.1|  378|Caenorhabditis elegans ELAV-type RNA
           binding protein variantC protein.
          Length = 378

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 488 RH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +H    LRE F+ FG+I   SV+ D++ GK RG  FV F
Sbjct: 152 KHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTF 189



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRA 413
           +R+   +G +    +++D  T+ SKG  F+T+       EAQ    + K+   +  P + 
Sbjct: 72  RRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQM 131

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P +   R E     +KLF+  L +   EE+L
Sbjct: 132 KPADTENRNE-----RKLFIGQLSKKHNEENL 158


>EF523766-1|ABS18832.1|  584|Caenorhabditis elegans ELAV-type RNA
           binding protein variantA protein.
          Length = 584

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 488 RH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +H    LRE F+ FG+I   SV+ D++ GK RG  FV F
Sbjct: 152 KHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTF 189



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRA 413
           +R+   +G +    +++D  T+ SKG  F+T+       EAQ    + K+   +  P + 
Sbjct: 72  RRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQM 131

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P +   R E     +KLF+  L +   EE+L
Sbjct: 132 KPADTENRNE-----RKLFIGQLSKKHNEENL 158



 Score = 31.5 bits (68), Expect = 0.68
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           F+ FG I+S  V  DK T   + FGFV +++
Sbjct: 519 FAPFGGILSAKVFIDKVTNLSKCFGFVSYEN 549


>AB052819-1|BAC65239.1|  351|Caenorhabditis elegans PIP-1 protein.
          Length = 351

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVP--R 422
           A+G ++ V ++ + +   SKGFGF+T       ++A+       + GRI+E +RA P  R
Sbjct: 73  AYGRVLSVEIVTNDRG--SKGFGFVTLDSIESCEKARAALHESHVQGRIIEVRRATPTRR 130

Query: 423 EEIKRPE 443
           + I  P+
Sbjct: 131 KLINNPQ 137


>Z35663-4|CAA84724.1|  307|Caenorhabditis elegans Hypothetical
           protein T04A8.6 protein.
          Length = 307

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + L  YF  FGN++ + V  ++ TG  +G+ +V FD+
Sbjct: 46  KELLGYFRQFGNVLRIRVARNRRTGNHKGWAYVGFDN 82


>U21320-5|AAA62536.2|  332|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 7 protein.
          Length = 332

 Score = 35.5 bits (78), Expect = 0.042
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +LR  F  +G I  +++V D E GK RG+ F+E+ D
Sbjct: 119 KLRREFEAYGKIKKLTMVHD-EAGKPRGYAFIEYSD 153



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +1

Query: 130 ILNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSL-KEFYEHGE 261
           I    P+E+    E+P  T  LF+G ++Y T++S L +EF  +G+
Sbjct: 87  IATWNPAENPRASEDPYRT--LFVGRINYETSESKLRREFEAYGK 129


>AF038623-4|AAO91699.1|  177|Caenorhabditis elegans Hypothetical
           protein T08B6.5 protein.
          Length = 177

 Score = 35.1 bits (77), Expect = 0.055
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           + E+F+  G +  V++  DK TG ++ F FVEF   + V
Sbjct: 62  IEEHFAVCGKVARVTIPKDKFTGYQKNFAFVEFQKLESV 100


>Z78536-3|CAB01717.2|  360|Caenorhabditis elegans Hypothetical
           protein C07A4.1 protein.
          Length = 360

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+  F+ FG +    V+ D +T K +G+GFV F
Sbjct: 151 LKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSF 183



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 11/35 (31%), Positives = 24/35 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +GE+ +  V++D +T++SKG+GF+++      + A
Sbjct: 158 FGEVSEAKVIRDVQTQKSKGYGFVSFPNKQNAENA 192


>Z49910-5|CAA90120.1|  411|Caenorhabditis elegans Hypothetical
           protein F44G4.4a protein.
          Length = 411

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 3/86 (3%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTK---RSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           E +  VV  + K K    SKGFGF+  S     ++      H IDGR  + K    R++ 
Sbjct: 194 EDIGTVVFCEIKRKSDGNSKGFGFVRMSSVGEQNKVLAIPQHMIDGRRCDVKVPDGRDKQ 253

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP    ++ ++FV  L   ++E  L
Sbjct: 254 GRP----SISRIFVGRLTDKVDEHQL 275



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++YF   G +V   +   K  G  +GFGFV        ++V     H I
Sbjct: 190 QKYFEDIGTVVFCEIKR-KSDGNSKGFGFVRMSSVGEQNKVLAIPQHMI 237


>Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical
           protein T23F6.4 protein.
          Length = 872

 Score = 34.3 bits (75), Expect = 0.096
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+  F  +G +  V VV DK+TG  +GF  VEF
Sbjct: 295 LQFLFKKYGEVSEVQVVIDKKTGACKGFAIVEF 327



 Score = 29.1 bits (62), Expect = 3.6
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKK---RGFGFVEFDDYDPVDR 628
           + +   F TFG + ++ +   K+ G+K   RGFGFV+F   D   R
Sbjct: 762 KEVETLFETFGAVKTIRI--PKKPGQKQQHRGFGFVDFISADEAHR 805


>Z68297-5|CAC70081.1|  394|Caenorhabditis elegans Hypothetical
           protein F11A10.7 protein.
          Length = 394

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
 Frame = +2

Query: 515 YFST-FGNIVSVSVVTDKETGKKRGFGFVEF 604
           +FS   G + +V +V DK+TGK +GF FV F
Sbjct: 265 FFSAQIGPVEAVRIVRDKDTGKGKGFAFVNF 295


>AF003145-3|AAB57717.1|  751|Caenorhabditis elegans Cpeb polya
           binding family protein 3 protein.
          Length = 751

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 1/33 (3%)
 Frame = +1

Query: 163 DYEEPEHTRKLFIGGLDYRTTDSSLKE-FYEHG 258
           DY  P  +RK+F+GG+ +  T+++LK+ F E G
Sbjct: 287 DYTSPTFSRKIFVGGVPWDITEAALKDSFGEFG 319


>U00052-10|AAK21429.2|  289|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 5 protein.
          Length = 289

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Frame = +2

Query: 386 RKNCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDK 565
           R   R +  +S  R    RS     +VV         +  L E FS +G I +V +  D+
Sbjct: 109 RSGSRQRRRASPRRSPAARSASPAKRVVIKNLSRNVLKTHLEEIFSIYGAIKNVDLPPDR 168

Query: 566 -ETGKKRGFGFVEFDDYDPVDR 628
                 RG+G+VE+D+ +  ++
Sbjct: 169 FHNHVHRGYGYVEYDNLEDAEK 190


>EF523767-1|ABS18833.1|  193|Caenorhabditis elegans ELAV-type RNA
           binding protein variantB protein.
          Length = 193

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRA 413
           +R+   +G +    +++D  T+ SKG  F+T+       EAQ    + K+   +  P + 
Sbjct: 72  RRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQM 131

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P +   R E     +KLF+  L +   EE+L
Sbjct: 132 KPADTENRNE-----RKLFIGQLSKKHNEENL 158



 Score = 31.1 bits (67), Expect = 0.90
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 488 RH*RRRLREYFSTFGNIVSVSVVTDKETGKKRG 586
           +H    LRE F+ FG+I   SV+ D++ GK RG
Sbjct: 152 KHNEENLREIFAKFGHIEDCSVLRDQD-GKSRG 183


>Z46676-8|CAB60993.2|  388|Caenorhabditis elegans Hypothetical
           protein C08B11.5 protein.
          Length = 388

 Score = 31.9 bits (69), Expect = 0.51
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           G +VSV++  D+ T   +GFGFVEF   +  D
Sbjct: 37  GPVVSVNMPKDRVTANHQGFGFVEFMGEEDAD 68



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEIK 434
           G +V V + KD  T   +GFGF+ +      D A +     K+ G+ ++  +A   E  K
Sbjct: 37  GPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYAIKILNMIKLYGKPIKVNKASAHE--K 94

Query: 435 RPEASATVKKLFVAGLKQDIEEE 503
             +  A +   FV  L  +++E+
Sbjct: 95  NMDVGANI---FVGNLDPEVDEK 114


>U24189-3|AAC47514.1|  398|Caenorhabditis elegans RRM-type RNA
           binding protein protein.
          Length = 398

 Score = 31.9 bits (69), Expect = 0.51
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           G +VSV++  D+ T   +GFGFVEF   +  D
Sbjct: 47  GPVVSVNMPKDRVTANHQGFGFVEFMGEEDAD 78



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEIK 434
           G +V V + KD  T   +GFGF+ +      D A +     K+ G+ ++  +A   E  K
Sbjct: 47  GPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYAIKILNMIKLYGKPIKVNKASAHE--K 104

Query: 435 RPEASATVKKLFVAGLKQDIEEE 503
             +  A +   FV  L  +++E+
Sbjct: 105 NMDVGANI---FVGNLDPEVDEK 124


>Z97628-2|CAB10726.2|  427|Caenorhabditis elegans Hypothetical
           protein F39H2.2a protein.
          Length = 427

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS FG I +  +V D+ +G    + F+EFD+
Sbjct: 261 FSRFGKINNCEIVRDRRSGDSLQYAFIEFDN 291


>Z81080-5|CAB03088.2|  427|Caenorhabditis elegans Hypothetical
           protein F39H2.2a protein.
          Length = 427

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS FG I +  +V D+ +G    + F+EFD+
Sbjct: 261 FSRFGKINNCEIVRDRRSGDSLQYAFIEFDN 291


>Z81080-2|CAD56584.1|  358|Caenorhabditis elegans Hypothetical
           protein F39H2.2b protein.
          Length = 358

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS FG I +  +V D+ +G    + F+EFD+
Sbjct: 192 FSRFGKINNCEIVRDRRSGDSLQYAFIEFDN 222


>U80455-2|AAB37882.2|  420|Caenorhabditis elegans Elav-type rna
           binding protein familyprotein 1, isoform b protein.
          Length = 420

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           F+ FG I+S  V  DK T   + FGFV +++
Sbjct: 355 FAPFGGILSAKVFIDKVTNLSKCFGFVSYEN 385


>AC024791-23|AAM81102.1|  346|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform c protein.
          Length = 346

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR  F  FG I S+++  D  TG  + F FVE++
Sbjct: 118 LRRAFDPFGPIKSINMSWDPATGHHKTFAFVEYE 151



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +K +  A+GEIV   + + P  +  +GFG++ ++      EA
Sbjct: 223 LKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNNLTSQSEA 264



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  F  FG IV   +         RGFG++EF++
Sbjct: 223 LKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNN 257


>AC024791-22|AAF60676.1|  339|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform a protein.
          Length = 339

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR  F  FG I S+++  D  TG  + F FVE++
Sbjct: 118 LRRAFDPFGPIKSINMSWDPATGHHKTFAFVEYE 151



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +K +  A+GEIV   + + P  +  +GFG++ ++      EA
Sbjct: 223 LKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNNLTSQSEA 264



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  F  FG IV   +         RGFG++EF++
Sbjct: 223 LKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNN 257


>AC024791-21|AAF60666.1|  749|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform b protein.
          Length = 749

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR  F  FG I S+++  D  TG  + F FVE++
Sbjct: 118 LRRAFDPFGPIKSINMSWDPATGHHKTFAFVEYE 151



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +K +  A+GEIV   + + P  +  +GFG++ ++      EA
Sbjct: 223 LKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNNLTSQSEA 264



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  F  FG IV   +         RGFG++EF++
Sbjct: 223 LKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNN 257


>Z74031-14|CAD66220.1|  187|Caenorhabditis elegans Hypothetical
           protein F32D8.13 protein.
          Length = 187

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 15/35 (42%), Positives = 21/35 (60%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVE 601
           RR   EYFS     V++ + T +E  K+RG+ FVE
Sbjct: 107 RRTDYEYFSANYRTVTIRIETSEEDRKQRGYQFVE 141


>Z36238-4|CAD82915.1|  286|Caenorhabditis elegans Hypothetical
           protein R74.5b protein.
          Length = 286

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREEIK 434
           G +VDV ++ + +   SKGFGF+T       D A+       I+GR VE   A  R   K
Sbjct: 6   GPVVDVEIIFNERG--SKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNK 63

Query: 435 RPEASATV 458
           + +   +V
Sbjct: 64  KAKPLMSV 71



 Score = 27.9 bits (59), Expect = 8.4
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           F   G +V V ++ + E G K GFGFV   + D  DR   + N
Sbjct: 2   FEKVGPVVDVEIIFN-ERGSK-GFGFVTMQNPDDADRARAEFN 42


>Z36238-3|CAA85276.1|  404|Caenorhabditis elegans Hypothetical
           protein R74.5a protein.
          Length = 404

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREEIK 434
           G +VDV ++ + +   SKGFGF+T       D A+       I+GR VE   A  R   K
Sbjct: 124 GPVVDVEIIFNERG--SKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNK 181

Query: 435 RPEASATV 458
           + +   +V
Sbjct: 182 KAKPLMSV 189



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   F   G +V V ++ + E G K GFGFV   + D  DR   + N
Sbjct: 116 LTAMFEKVGPVVDVEIIFN-ERGSK-GFGFVTMQNPDDADRARAEFN 160


>DQ485531-1|ABF22491.1|  404|Caenorhabditis elegans RNA-binding
           protein ASD-1 protein.
          Length = 404

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREEIK 434
           G +VDV ++ + +   SKGFGF+T       D A+       I+GR VE   A  R   K
Sbjct: 124 GPVVDVEIIFNERG--SKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNK 181

Query: 435 RPEASATV 458
           + +   +V
Sbjct: 182 KAKPLMSV 189



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   F   G +V V ++ + E G K GFGFV   + D  DR   + N
Sbjct: 116 LTAMFEKVGPVVDVEIIFN-ERGSK-GFGFVTMQNPDDADRARAEFN 160


>U23450-1|AAK31467.2|  422|Caenorhabditis elegans Cpeb polya binding
           family protein 2 protein.
          Length = 422

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +2

Query: 506 LREYFS-TFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L  +F  T+G++V V +  D +    RG G V F DYD
Sbjct: 302 LAHFFEQTYGHVVCVGIDIDNKFKYPRGSGRVAFSDYD 339


>U80436-5|AAT68892.1| 2140|Caenorhabditis elegans Uncoordinated
            protein 73, isoform f protein.
          Length = 2140

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/70 (25%), Positives = 32/70 (45%)
 Frame = +3

Query: 264  IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE 443
            ++ +VV +D K +          +  + +DE   N         VEP+ A+P +  K PE
Sbjct: 1744 VIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEKTPE 1803

Query: 444  ASATVKKLFV 473
             +A  K+ +V
Sbjct: 1804 ETARFKRSYV 1813


>U80436-4|AAC71111.1|  552|Caenorhabditis elegans Uncoordinated
           protein 73, isoform d protein.
          Length = 552

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/70 (25%), Positives = 32/70 (45%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE 443
           ++ +VV +D K +          +  + +DE   N         VEP+ A+P +  K PE
Sbjct: 98  VIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEKTPE 157

Query: 444 ASATVKKLFV 473
            +A  K+ +V
Sbjct: 158 ETARFKRSYV 167


>U80436-3|AAL06029.3|  633|Caenorhabditis elegans Uncoordinated
           protein 73, isoform e protein.
          Length = 633

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/70 (25%), Positives = 32/70 (45%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE 443
           ++ +VV +D K +          +  + +DE   N         VEP+ A+P +  K PE
Sbjct: 179 VIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEKTPE 238

Query: 444 ASATVKKLFV 473
            +A  K+ +V
Sbjct: 239 ETARFKRSYV 248


>U80436-2|AAC71110.1|  928|Caenorhabditis elegans Uncoordinated
           protein 73, isoform c protein.
          Length = 928

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/70 (25%), Positives = 32/70 (45%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE 443
           ++ +VV +D K +          +  + +DE   N         VEP+ A+P +  K PE
Sbjct: 184 VIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEKTPE 243

Query: 444 ASATVKKLFV 473
            +A  K+ +V
Sbjct: 244 ETARFKRSYV 253


>U80436-1|AAC71108.1| 2488|Caenorhabditis elegans Uncoordinated
            protein 73, isoform a protein.
          Length = 2488

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/70 (25%), Positives = 32/70 (45%)
 Frame = +3

Query: 264  IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE 443
            ++ +VV +D K +          +  + +DE   N         VEP+ A+P +  K PE
Sbjct: 1744 VIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEKTPE 1803

Query: 444  ASATVKKLFV 473
             +A  K+ +V
Sbjct: 1804 ETARFKRSYV 1813


>AF048834-1|AAC12931.1| 2488|Caenorhabditis elegans guanine nucleotide
            exchange factorUNC-73A protein.
          Length = 2488

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/70 (25%), Positives = 32/70 (45%)
 Frame = +3

Query: 264  IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE 443
            ++ +VV +D K +          +  + +DE   N         VEP+ A+P +  K PE
Sbjct: 1744 VIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEKTPE 1803

Query: 444  ASATVKKLFV 473
             +A  K+ +V
Sbjct: 1804 ETARFKRSYV 1813


>AL137227-1|CAB70238.2|  611|Caenorhabditis elegans Hypothetical
           protein F58D5.1 protein.
          Length = 611

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITY 332
           G+I D+ +M DP +  S+G+ F+TY
Sbjct: 224 GKIWDLRLMMDPMSGASRGYAFVTY 248



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +2

Query: 539 VSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ-QNHQIKRFN 667
           V V  V D E  K RGF FV+F D+     +  +   H+I+ FN
Sbjct: 311 VIVYSVPDNEKIKNRGFCFVDFIDHKTASDIKRKIAQHKIRPFN 354


>Z81037-3|CAB02750.1|  205|Caenorhabditis elegans Hypothetical
           protein C17E4.5 protein.
          Length = 205

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + ++F   G++  V++  D+ +G  +GF +VEF +
Sbjct: 94  IEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTE 128


>U41531-7|AAA83161.2|  415|Caenorhabditis elegans Feminizing gene on
           x protein 1 protein.
          Length = 415

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           +K +   +G + DV ++ + +   SKGFGF+T  +    + A Q      I+GR +E   
Sbjct: 169 LKTMFEKFGVVSDVEIIFNERG--SKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNC 226

Query: 411 AVPREEIKR 437
           A  R   K+
Sbjct: 227 ATARVHSKK 235


>U14946-1|AAA67723.1|  415|Caenorhabditis elegans ribonucleoprotein
           protein.
          Length = 415

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           +K +   +G + DV ++ + +   SKGFGF+T  +    + A Q      I+GR +E   
Sbjct: 169 LKTMFEKFGVVSDVEIIFNERG--SKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNC 226

Query: 411 AVPREEIKR 437
           A  R   K+
Sbjct: 227 ATARVHSKK 235


>AF098993-1|AAC67471.2|  367|Caenorhabditis elegans Zinc finger
           transcription factorfamily protein 4 protein.
          Length = 367

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           E F  FG I++V+         ++GFGFV+F++    D  C   N
Sbjct: 102 ELFRPFGKIIAVNYFA------QQGFGFVQFNEAGSADESCRSLN 140


>Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical
           protein T07D4.4a protein.
          Length = 1022

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           GNI+SV +  +K   K RG GF       P     ++ NH+  RF +
Sbjct: 102 GNIISVGIHKEKPACK-RGGGFGTNRSMAPCPPAIIKNNHEGGRFGV 147


>U50193-8|AAL11478.2|  394|Caenorhabditis elegans Hypothetical
           protein ZK328.6 protein.
          Length = 394

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +3

Query: 384 DGRIVEPKRAVPREEIKRPEASATVKKLFVAG 479
           +G + +PK+ V ++ +K+ +  A +KKL VAG
Sbjct: 323 EGVLPKPKKKVVKKVVKKKKPIAFIKKLEVAG 354


>AC087081-13|AAK66033.1|  253|Caenorhabditis elegans Hypothetical
           protein Y82E9BL.6 protein.
          Length = 253

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 13/50 (26%), Positives = 27/50 (54%)
 Frame = -1

Query: 682 FSHPNVESFNLVILLQAYSVNWIIIIKLYKTKAPFLSCFFICHNTNRNNI 533
           ++HP+   FN++  L   ++    IIK+    A  ++C+   HN+ + N+
Sbjct: 168 WTHPSQNEFNIINKLWPETIYLCPIIKIMSIPAVIIACY--AHNSAKINL 215


>U97407-6|AAB52481.1|  751|Caenorhabditis elegans Tyrosinase protein
           4 protein.
          Length = 751

 Score = 24.6 bits (51), Expect(2) = 8.9
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +2

Query: 254 MGRNCRCSCNERPKNQEIKRI 316
           M  NCR SCN      E++R+
Sbjct: 634 MAENCRSSCNSCYTQSELRRM 654



 Score = 21.4 bits (43), Expect(2) = 8.9
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +2

Query: 239 KNSMSMGRNCRCSC 280
           KN+  M  NCR SC
Sbjct: 586 KNTRYMACNCRVSC 599


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,070,942
Number of Sequences: 27780
Number of extensions: 319097
Number of successful extensions: 1104
Number of sequences better than 10.0: 90
Number of HSP's better than 10.0 without gapping: 894
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1094
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1830096852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).