SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30009
         (801 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81513-13|CAB04180.2| 1213|Caenorhabditis elegans Hypothetical p...    29   3.9  
U00033-3|AAC48304.2|  351|Caenorhabditis elegans Serpentine rece...    28   8.9  
U00033-2|AAP68944.1|  351|Caenorhabditis elegans Serpentine rece...    28   8.9  

>Z81513-13|CAB04180.2| 1213|Caenorhabditis elegans Hypothetical
           protein F26D2.10 protein.
          Length = 1213

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 27/89 (30%), Positives = 42/89 (47%)
 Frame = -2

Query: 530 SLLSNLKCAISIPV*AKIPRRYPYSQILGLMGTKLVLIEKFSRAGTTWF*LIN*FIYLVA 351
           S +S LK     P    I     Y  +LG + + L L+EK  ++ T+     N  + L+ 
Sbjct: 575 STVSKLKSLRMFPDGETISTMLEYLDLLGKVQSNLTLVEKEIKSSTSHVNSTNNPV-LLL 633

Query: 350 PTKSSSIQNIEKLTKVHDRLHLNYR*NRQ 264
            T  + I+NI   T+V + L  N R +RQ
Sbjct: 634 KTPQALIKNIGTSTRVLEDLE-NVRQHRQ 661


>U00033-3|AAC48304.2|  351|Caenorhabditis elegans Serpentine
           receptor, class b (beta)protein 9 protein.
          Length = 351

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +1

Query: 205 IILTFLKRKLFIYLLFMSMRCRFHL*LRCNLSCTFVSFSMFCIDDDFVG 351
           ++  F    LF ++ F  ++  FH  L+C L   FV+   F I+   VG
Sbjct: 40  LVACFAFPPLFYFIFFKLIKSSFHGNLKCVLIGYFVTVLAFTINFQIVG 88


>U00033-2|AAP68944.1|  351|Caenorhabditis elegans Serpentine
           receptor, class b (beta)protein 8 protein.
          Length = 351

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +1

Query: 205 IILTFLKRKLFIYLLFMSMRCRFHL*LRCNLSCTFVSFSMFCIDDDFVG 351
           ++  F    LF ++ F  ++  FH  L+C L   FV+   F I+   VG
Sbjct: 40  LVACFAFPPLFYFIFFKLIKSSFHGNLKCVLIGYFVTVLAFTINFQIVG 88


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,655,608
Number of Sequences: 27780
Number of extensions: 350286
Number of successful extensions: 630
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 614
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 630
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1956310428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).