SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z99281-10|CAB16516.1|  473|Caenorhabditis elegans Hypothetical p...    62   1e-10
AL117204-12|CAB55127.1|  385|Caenorhabditis elegans Hypothetical...    30   0.94 
Z50029-8|CAA90342.2|  668|Caenorhabditis elegans Hypothetical pr...    28   2.9  
AC199166-1|ABO33245.1|  343|Caenorhabditis elegans F-box a prote...    28   2.9  
AF016424-6|AAB65333.1|  366|Caenorhabditis elegans Transforming ...    28   3.8  
Z74043-7|CAA98539.2|  705|Caenorhabditis elegans Hypothetical pr...    27   5.0  
AF067220-6|AAC16980.2|  303|Caenorhabditis elegans Hypothetical ...    27   5.0  
Z81044-6|CAB02806.1|  360|Caenorhabditis elegans Hypothetical pr...    27   6.6  
AF125956-3|AAD14726.3|  264|Caenorhabditis elegans Hypothetical ...    27   8.8  

>Z99281-10|CAB16516.1|  473|Caenorhabditis elegans Hypothetical
           protein Y57G11C.15 protein.
          Length = 473

 Score = 62.5 bits (145), Expect = 1e-10
 Identities = 29/38 (76%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ EMGG+S + F
Sbjct: 436 GAIGSGTGILLAVTIIYQYFEIFVKEQQEMGGVSAMFF 473



 Score = 60.1 bits (139), Expect = 8e-10
 Identities = 27/29 (93%), Positives = 28/29 (96%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSV ADF+GAIGSG
Sbjct: 413 YIPTAAAFGGLCIGALSVTADFMGAIGSG 441


>AL117204-12|CAB55127.1|  385|Caenorhabditis elegans Hypothetical
           protein Y116A8C.21 protein.
          Length = 385

 Score = 29.9 bits (64), Expect = 0.94
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 7/72 (9%)
 Frame = -1

Query: 240 IKTELNAAVRLP-------LSLRDLEEQCAHAAHLRLFLDKDLEVLVNDGDGEQYPSARS 82
           I  +LN+ VR+        L+  +  E C H       LD+ LE+  N+GD  QY   +S
Sbjct: 39  INMDLNSCVRIVSDFSTVILASWNSSENC-HLFGFDQILDQILEIKTNEGDMGQYLILKS 97

Query: 81  RWPRGSRPALTE 46
             P  + PA  E
Sbjct: 98  DQPNSTCPAFPE 109


>Z50029-8|CAA90342.2|  668|Caenorhabditis elegans Hypothetical
           protein ZC504.3 protein.
          Length = 668

 Score = 28.3 bits (60), Expect = 2.9
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = -1

Query: 369 CLQLNKY*ILNLIFSIKYNDVFTSNTTRYENVHLMMSIRAE 247
           C  +++Y ILN+I    Y +VF    TR + V  +   + E
Sbjct: 298 CQHISEYVILNVIAEGTYGEVFRGKNTRTDEVVALKRFKME 338


>AC199166-1|ABO33245.1|  343|Caenorhabditis elegans F-box a protein
           protein 6 protein.
          Length = 343

 Score = 28.3 bits (60), Expect = 2.9
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = -3

Query: 361 TQQILNLKSNFFD--KVQRCIHIQHYQI*KRTPNDVDSS 251
           TQQ LN+ + F +  + ++CIH++   I   +PND+ S+
Sbjct: 151 TQQDLNVTTYFLNILRSKQCIHVKELSIIFVSPNDIIST 189


>AF016424-6|AAB65333.1|  366|Caenorhabditis elegans Transforming
           growth factor betafamily protein 2 protein.
          Length = 366

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = -3

Query: 412 RTRRHAHNTTPVGALPSTQQILNLKSNFFDK 320
           R+RR A +TTP+ A P  Q++   +S +F+K
Sbjct: 229 RSRRSA-STTPISAPPMRQKVKRSESAYFEK 258


>Z74043-7|CAA98539.2|  705|Caenorhabditis elegans Hypothetical
           protein T19B10.5 protein.
          Length = 705

 Score = 27.5 bits (58), Expect = 5.0
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = -3

Query: 106 RAVSQCPE-PMAPRKSASTDRAPMHSPPNAAAV 11
           R + QC E P  PRK  S   +P++ PP +  V
Sbjct: 457 RKLEQCTELPPKPRKMVSRSPSPVNKPPPSPKV 489


>AF067220-6|AAC16980.2|  303|Caenorhabditis elegans Hypothetical
           protein C33E10.8 protein.
          Length = 303

 Score = 27.5 bits (58), Expect = 5.0
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = -1

Query: 330 FSIKYNDVFTSNTTRYENVHLMM 262
           FSIKYND    NT+R E  + MM
Sbjct: 199 FSIKYNDFLLFNTSRIEMNNEMM 221


>Z81044-6|CAB02806.1|  360|Caenorhabditis elegans Hypothetical
           protein C30H6.2 protein.
          Length = 360

 Score = 27.1 bits (57), Expect = 6.6
 Identities = 18/59 (30%), Positives = 23/59 (38%)
 Frame = +3

Query: 48  LSVLADFLGAIGSGHWDTARRHHHLPVLRDLCQGTSGDGRHEHTALLSLVMIAAVGPLR 224
           L ++   +G    GH +    H H     DL  GTSG G   H      +M   V P R
Sbjct: 62  LHIIPQVVGVHDHGH-NHGHSHEHHHEHTDLENGTSGHGHSHHHDDSDRIMWYTVTPAR 119


>AF125956-3|AAD14726.3|  264|Caenorhabditis elegans Hypothetical
           protein DC2.5 protein.
          Length = 264

 Score = 26.6 bits (56), Expect = 8.8
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = +2

Query: 191 SRNDSGSRTAAFSSVFIVVSARIDIIRCTFSYLVVLDVNTSLYFIEK 331
           +RN + S T   S +     ARIDI++C  S L  +      Y  +K
Sbjct: 3   NRNYAASETLKQSLLCETPDARIDIVQCDLSSLASVKKTAEEYLTKK 49


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,844,101
Number of Sequences: 27780
Number of extensions: 221060
Number of successful extensions: 725
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 689
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 725
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 829055604
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).