SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC087079-15|ABF71716.1|  152|Caenorhabditis elegans Hypothetical...    29   3.8  
AF548287-1|AAN40683.1| 2238|Caenorhabditis elegans poly ADP-ribo...    29   5.1  
AF047664-2|AAC04454.2| 2276|Caenorhabditis elegans Poly(adp-ribo...    29   5.1  
AF047664-1|AAO12392.1| 2238|Caenorhabditis elegans Poly(adp-ribo...    29   5.1  
Z70756-10|CAI46587.1|  228|Caenorhabditis elegans Hypothetical p...    28   6.7  
Z29121-1|CAA82387.3|  324|Caenorhabditis elegans Hypothetical pr...    28   6.7  
Z81110-6|CAB03260.2| 1011|Caenorhabditis elegans Hypothetical pr...    28   8.9  
U13875-11|AAA21158.1| 1193|Caenorhabditis elegans Rna polymerase...    28   8.9  
U10333-1|AAA50224.1|  859|Caenorhabditis elegans RNA polymerase ...    28   8.9  

>AC087079-15|ABF71716.1|  152|Caenorhabditis elegans Hypothetical
           protein Y37E3.19 protein.
          Length = 152

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 24/97 (24%), Positives = 37/97 (38%), Gaps = 11/97 (11%)
 Frame = +3

Query: 348 HYAAPVAKVIAPAHKVLVSAHHE----EEYAHPKYDFAYSVADGHSGDNK--SQHESRDG 509
           H+  P  K   P   +L   H +     E++         V   HS D +  S   + D 
Sbjct: 56  HFTPPHIKTAVPTRSLLRQKHQQCPVHYEFSEDATTTTTFVDSAHSSDIQFDSTQSASDS 115

Query: 510 TL-----CTASTLWLKLTVQCARLSTPLTTTTAFNAI 605
           ++     CT      ++  QC   +T  TTTT+F  I
Sbjct: 116 SISFLKRCTCFCAQKRVRFQCPPTTTTTTTTTSFGFI 152


>AF548287-1|AAN40683.1| 2238|Caenorhabditis elegans poly ADP-ribose
            metabolism enzyme-5 protein.
          Length = 2238

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 19/65 (29%), Positives = 27/65 (41%)
 Frame = +3

Query: 315  AAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQH 494
            A  P   A P+ + A     I  A    V A  E +        + S  DG + +NKS+H
Sbjct: 1504 ATGPRCVAVPMRFGATSRAFIPAAAFASVPARVESDEEEEDNSGSESGEDGAASENKSEH 1563

Query: 495  ESRDG 509
             S +G
Sbjct: 1564 GSENG 1568


>AF047664-2|AAC04454.2| 2276|Caenorhabditis elegans Poly(adp-ribose)
            metabolism enzymeprotein 5, isoform a protein.
          Length = 2276

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 19/65 (29%), Positives = 27/65 (41%)
 Frame = +3

Query: 315  AAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQH 494
            A  P   A P+ + A     I  A    V A  E +        + S  DG + +NKS+H
Sbjct: 1542 ATGPRCVAVPMRFGATSRAFIPAAAFASVPARVESDEEEEDNSGSESGEDGAASENKSEH 1601

Query: 495  ESRDG 509
             S +G
Sbjct: 1602 GSENG 1606


>AF047664-1|AAO12392.1| 2238|Caenorhabditis elegans Poly(adp-ribose)
            metabolism enzymeprotein 5, isoform b protein.
          Length = 2238

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 19/65 (29%), Positives = 27/65 (41%)
 Frame = +3

Query: 315  AAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQH 494
            A  P   A P+ + A     I  A    V A  E +        + S  DG + +NKS+H
Sbjct: 1504 ATGPRCVAVPMRFGATSRAFIPAAAFASVPARVESDEEEEDNSGSESGEDGAASENKSEH 1563

Query: 495  ESRDG 509
             S +G
Sbjct: 1564 GSENG 1568


>Z70756-10|CAI46587.1|  228|Caenorhabditis elegans Hypothetical
           protein T06E4.12 protein.
          Length = 228

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           + AAAP   A+P    AP A ++AP   VL +A
Sbjct: 55  VLAAAPTVLAAPAPLLAPPAPLLAPPAPVLAAA 87


>Z29121-1|CAA82387.3|  324|Caenorhabditis elegans Hypothetical
           protein ZK757.1 protein.
          Length = 324

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +3

Query: 528 TLWLKLTVQCARLSTPLTTTTAFNAIVSN 614
           ++WL +++ C  +S  L  T  FNA  SN
Sbjct: 270 SVWLHVSLVCNNISFSLADTNLFNAFTSN 298


>Z81110-6|CAB03260.2| 1011|Caenorhabditis elegans Hypothetical
           protein T01D3.3b protein.
          Length = 1011

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQ 613
           VHG+  L EA+GS R   + AD  + + R R Q
Sbjct: 18  VHGQLRLCEAEGSCR---HCADSRYSYYRCRMQ 47


>U13875-11|AAA21158.1| 1193|Caenorhabditis elegans Rna polymerase ii
           (b) subunit protein2 protein.
          Length = 1193

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 450 YSVADGHSGDNKSQHESRDGTLCTASTLWLKLTV-QCARLSTPL 578
           YS+A G+ GD K  H+SR G     + L    T+    R ++P+
Sbjct: 452 YSLATGNWGDQKKAHQSRAGVSQVLNRLTYTATLSHLRRANSPI 495


>U10333-1|AAA50224.1|  859|Caenorhabditis elegans RNA polymerase II,
           second largestsubunit protein.
          Length = 859

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 450 YSVADGHSGDNKSQHESRDGTLCTASTLWLKLTV-QCARLSTPL 578
           YS+A G+ GD K  H+SR G     + L    T+    R ++P+
Sbjct: 253 YSLATGNWGDQKKAHQSRAGVSQVLNRLTYTATLSHLRRANSPI 296


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,811,579
Number of Sequences: 27780
Number of extensions: 175356
Number of successful extensions: 596
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 570
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 595
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1935274832
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).