SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30006
         (796 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U64837-3|AAB04837.1|  782|Caenorhabditis elegans Hypothetical pr...    29   2.9  
Z49908-11|CAA90104.2|  355|Caenorhabditis elegans Hypothetical p...    28   6.7  
Z49070-5|CAA88872.2|  355|Caenorhabditis elegans Hypothetical pr...    28   6.7  
AF125956-4|AAD14723.1|  353|Caenorhabditis elegans Serpentine re...    28   6.7  
AF039716-7|AAB96735.3|  617|Caenorhabditis elegans Sodium:neurot...    28   6.7  
Z92784-2|CAB07193.3| 2029|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z81056-1|CAB02902.1|  319|Caenorhabditis elegans Hypothetical pr...    28   8.9  

>U64837-3|AAB04837.1|  782|Caenorhabditis elegans Hypothetical
           protein T27E4.6 protein.
          Length = 782

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +3

Query: 489 FVMINYCAFLVKQIRFYLLYSHYSVYFFLFTSFAYSFIFTLKFHGDI-INLLR*FVSYF* 665
           F  +++CAF+V  +  Y L+ +       +TSF + +     FH  I I +   F+++F 
Sbjct: 646 FGKLSFCAFIVHHMLLYFLF-NIQEEAPKYTSFWHEY-----FHYTIPIVIYSYFLAFFL 699

Query: 666 CVVIPIVLLPEGRLVLE 716
            VV+ I +L   RL+++
Sbjct: 700 SVVVEIPILRIDRLIID 716


>Z49908-11|CAA90104.2|  355|Caenorhabditis elegans Hypothetical
           protein T09F3.1 protein.
          Length = 355

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +1

Query: 685 YCCPRAGLSLNREYLVN 735
           YCCP+ G S  R YL +
Sbjct: 244 YCCPKCGASFTRRYLAS 260


>Z49070-5|CAA88872.2|  355|Caenorhabditis elegans Hypothetical
           protein T09F3.1 protein.
          Length = 355

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +1

Query: 685 YCCPRAGLSLNREYLVN 735
           YCCP+ G S  R YL +
Sbjct: 244 YCCPKCGASFTRRYLAS 260


>AF125956-4|AAD14723.1|  353|Caenorhabditis elegans Serpentine
           receptor, class h protein78 protein.
          Length = 353

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 1/20 (5%)
 Frame = +1

Query: 535 FIYYTV-IIVCIFFCSRVLL 591
           F+YYTV +I+C+FF S + L
Sbjct: 150 FVYYTVRVIICVFFSSILFL 169


>AF039716-7|AAB96735.3|  617|Caenorhabditis elegans
           Sodium:neurotransmitter symporterfamily protein 1
           protein.
          Length = 617

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 527 NSFLFIIQSL*CVFFFVHEFCLFVYFYF 610
           +  LF +  L C+  F+   CLF+Y+YF
Sbjct: 106 SQILFTMVVLACMTKFLSTLCLFLYYYF 133


>Z92784-2|CAB07193.3| 2029|Caenorhabditis elegans Hypothetical protein
            F31C3.3 protein.
          Length = 2029

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +3

Query: 93   PVPRKFPTWRIDTRPSPLAFYKPQRHSSDSIACIY 197
            P+P  FPT  +    SP+ FY   + +S    C Y
Sbjct: 899  PLPEPFPTHSVWKNMSPIKFYYDLQCASTEYNCTY 933


>Z81056-1|CAB02902.1|  319|Caenorhabditis elegans Hypothetical
           protein F09F3.1 protein.
          Length = 319

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
 Frame = +2

Query: 533 FLFIIQSL*CVFFFVHEFC-LFVYFYFEISW*YY*SLKMICFL 658
           F F + S+  + FF   FC +F++F F  SW      K +CF+
Sbjct: 18  FYFAVSSVAFLGFF-GTFCNIFLFFKFATSWKTLNGFKKLCFM 59


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,585,043
Number of Sequences: 27780
Number of extensions: 316656
Number of successful extensions: 733
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 698
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 732
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1935274832
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).