SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U58735-1|AAC48148.1|  891|Caenorhabditis elegans Hypothetical pr...    64   2e-10
AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse trans...    62   4e-10
AF025462-7|AAB71003.1|  805|Caenorhabditis elegans Hypothetical ...    62   4e-10
AC087794-3|AAG53700.1|  417|Caenorhabditis elegans Hypothetical ...    62   5e-10
AF016663-5|AAC70880.1|  864|Caenorhabditis elegans Hypothetical ...    61   8e-10
AC103567-9|AAL35735.1|  204|Caenorhabditis elegans Hypothetical ...    40   0.002
AF519108-1|AAM74222.1|  909|Caenorhabditis elegans EOR-1 protein.      32   0.44 
AF502568-1|AAM74151.1|  909|Caenorhabditis elegans EOR-1 protein.      32   0.44 
AF100669-8|AAK39268.1|  909|Caenorhabditis elegans Egl-1 suppres...    32   0.44 
AL132952-19|CAB63382.2| 1677|Caenorhabditis elegans Hypothetical...    31   0.77 
AF038614-10|AAB92063.1| 1655|Caenorhabditis elegans Hypothetical...    31   0.77 
U58738-4|AAB00604.1|  358|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z29561-4|CAD91697.1|  498|Caenorhabditis elegans Hypothetical pr...    30   2.3  
Z29561-3|CAD54153.1|  846|Caenorhabditis elegans Hypothetical pr...    30   2.3  
Z29561-2|CAD54152.1|  882|Caenorhabditis elegans Hypothetical pr...    30   2.3  
Z29561-1|CAA82667.2|  861|Caenorhabditis elegans Hypothetical pr...    30   2.3  
U73679-1|AAC67305.1|  861|Caenorhabditis elegans YNK1-a protein.       30   2.3  
L07144-12|AAM54162.1| 1053|Caenorhabditis elegans Hypothetical p...    30   2.3  
Z99710-9|CAN99658.1|  402|Caenorhabditis elegans Hypothetical pr...    29   4.1  
AF016663-3|AAC70878.1| 1170|Caenorhabditis elegans Hypothetical ...    29   4.1  
AF100669-1|AAK39265.1|  931|Caenorhabditis elegans Hypothetical ...    29   5.4  
Z54284-1|CAA91059.1| 2198|Caenorhabditis elegans Hypothetical pr...    28   9.5  
AF003151-17|ABJ99068.1|   99|Caenorhabditis elegans Hypothetical...    28   9.5  

>U58735-1|AAC48148.1|  891|Caenorhabditis elegans Hypothetical protein
            F20B4.7 protein.
          Length = 891

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 2/159 (1%)
 Frame = -3

Query: 516  DNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
            D   G+  +   L +L +ADDIVL+    +     L++L     + GL INT KT  +R 
Sbjct: 612  DTIPGMRVNGRNLTNLRFADDIVLIANHPNTASKMLQELVQKCSEVGLEINTGKTKVLR- 670

Query: 336  MSKNTTPLKLQDCGFEVSTEVYISGEL--LSNQGGSDEDIEIRIRKARGAFAQLKPVWES 163
             ++   P K+       +T++    E   L+ Q     +I  R R A  AF  +K   +S
Sbjct: 671  -NRFADPSKVYFGSPSPTTQLDDVDEYIYLNAQNNLMPEIHRRRRAAWAAFIGIKNTTDS 729

Query: 162  SVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQV 46
             +  ++I+  LFDSI+   L +G E W  TK L+ R+++
Sbjct: 730  -ITDKKIRANLFDSIILPALTYGSEAWTFTKALSERVRI 767



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L ++G     I +++  Y+  T       + +  P+  T GV+QG  +SP LF   L+ +
Sbjct: 538 LDEQGADGAYIDLLKECYKNCTTNFTPFHRPVAVPV--TKGVRQGDPISPNLFSACLEHV 595

Query: 530 MREV 519
            R++
Sbjct: 596 FRKL 599


>AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse
            transcriptase protein.
          Length = 1066

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 50/163 (30%), Positives = 80/163 (49%), Gaps = 6/163 (3%)
 Frame = -3

Query: 516  DNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
            D   G+  +   L +L +ADDIVL+    +     L++L     + GL INT KT  +R 
Sbjct: 783  DTIPGMRVNGRNLTNLRFADDIVLIANHPNIASKMLQELVQKCSEVGLEINTGKTKVLR- 841

Query: 336  MSKNTTPLKLQDCGFEVSTEV-----YIS-GELLSNQGGSDEDIEIRIRKARGAFAQLKP 175
             ++   P K+       +T++     YI  G  ++ Q     +I  R R A  AF  +K 
Sbjct: 842  -NRFADPSKVYFGSPSPTTQLDDVDEYIYLGRQINAQNNLMPEIHRRRRAAWAAFNGIKN 900

Query: 174  VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQV 46
              +S +  ++I+  LFDSIV   L +G E W  TK L+ R+++
Sbjct: 901  TTDS-ITDKKIRANLFDSIVLPALTYGSEAWTFTKALSERVRI 942



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L ++G     I +++  Y+  T       + +  P+  T GV+QG  +SP LF   L+ +
Sbjct: 709 LDEQGADGAYIDLLKECYKNCTTNFTPFHRPVAVPV--TKGVRQGDPISPNLFSACLEHV 766

Query: 530 MREV 519
            R++
Sbjct: 767 FRKL 770


>AF025462-7|AAB71003.1|  805|Caenorhabditis elegans Hypothetical
            protein K10F12.5 protein.
          Length = 805

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 50/163 (30%), Positives = 80/163 (49%), Gaps = 6/163 (3%)
 Frame = -3

Query: 516  DNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
            D   G+  +   L +L +ADDIVL+    +     L++L     + GL INT KT  +R 
Sbjct: 522  DTIPGMRVNGRNLTNLRFADDIVLIANHPNIASKMLQELVQKCSEVGLEINTGKTKVLR- 580

Query: 336  MSKNTTPLKLQDCGFEVSTEV-----YIS-GELLSNQGGSDEDIEIRIRKARGAFAQLKP 175
             ++   P K+       +T++     YI  G  ++ Q     +I  R R A  AF  +K 
Sbjct: 581  -NRFADPSKVYFGSPSPTTQLDDVDEYIYLGRQINAQNNLMPEIHRRRRAAWAAFNGIKN 639

Query: 174  VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQV 46
              +S +  ++I+  LFDSIV   L +G E W  TK L+ R+++
Sbjct: 640  TTDS-ITDKKIRANLFDSIVLPALTYGSEAWTFTKALSERVRI 681



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L ++G     I +++  Y+  T       + +  P+  T GV+QG  +SP LF   L+ +
Sbjct: 448 LDEQGADGAYIDLLKECYKNCTTNFTPFHRPVAVPV--TKGVRQGDPISPNLFSACLEHV 505

Query: 530 MREV 519
            R++
Sbjct: 506 FRKL 509


>AC087794-3|AAG53700.1|  417|Caenorhabditis elegans Hypothetical
           protein Y32G9A.9 protein.
          Length = 417

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 48/151 (31%), Positives = 76/151 (50%), Gaps = 6/151 (3%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           L +L +ADDIVL+    +     L++L     + GL INT KT  +R  ++   P K+  
Sbjct: 146 LTNLRFADDIVLIANHPNTASKMLQELVQKCSEVGLEINTGKTKVLR--NRFADPSKVYF 203

Query: 300 CGFEVSTEV-----YIS-GELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIK 139
                +T++     YI  G  ++ Q     +I  R R A  AF  +K   +S +  ++I+
Sbjct: 204 GNPSSTTQLDDVDEYIYLGRQINAQNNLMPEIHRRRRAAWAAFNGIKNTTDS-ITDKKIR 262

Query: 138 LTLFDSIVKSVLLFGCETWRVTKTLTNRLQV 46
             LFDSIV   L +G E W  TK L+ R+++
Sbjct: 263 ANLFDSIVLPALTYGSEAWTFTKALSERVRI 293



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 16/63 (25%), Positives = 31/63 (49%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L ++G     I +++  Y+  T       +    + +T GV+QG  +SP LF   L+ + 
Sbjct: 60  LDEQGADEAYIDLLKECYKNCTTNFT-PFLRPITVPVTKGVRQGDPISPNLFSACLEHVF 118

Query: 527 REV 519
           R++
Sbjct: 119 RKL 121


>AF016663-5|AAC70880.1|  864|Caenorhabditis elegans Hypothetical
            protein F21E9.5 protein.
          Length = 864

 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 49/165 (29%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = -3

Query: 510  TRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR--- 340
            T GI  +   L +L +ADDIVL+          L +L       GL+INT KT  +R   
Sbjct: 557  TEGIRVNGQNLTNLRFADDIVLVAHNPRTASQMLTELVEKCSSVGLKINTGKTKVLRNRF 616

Query: 339  -------VMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL 181
                   +   NTT + + D    V+  +Y+ G  +++      ++  R R A  AF  +
Sbjct: 617  AYKRKVEIRCPNTTNIIIDD----VNEYIYL-GRQINDSNNLLPELHRRRRAAWAAFTNI 671

Query: 180  KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQV 46
            K   +  +   R++  LFDS V   L +G E W  TK L  R++V
Sbjct: 672  KSTTDQ-ITCPRLRANLFDSTVLPALTYGSEAWTFTKELAERVRV 715



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYR--GSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDD 534
           L+Q+G+    I ++Q  Y    +T    H  V    + +T GV+QG  +SP LF   L+ 
Sbjct: 483 LQQQGVQRGYINLLQECYTDCSTTFTPFHKNVT---VPVTRGVRQGDPISPNLFSACLEH 539

Query: 533 IMREV 519
           + R++
Sbjct: 540 VFRQL 544


>AC103567-9|AAL35735.1|  204|Caenorhabditis elegans Hypothetical
           protein Y51F10.8 protein.
          Length = 204

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = -3

Query: 228 DIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQ 49
           ++  R R A  AF  +K   +  +   R++  LFDS V   L +G E W  TK L  R++
Sbjct: 19  ELHRRRRAAWAAFTNIKSTTDQ-ITCPRLRANLFDSTVLPALTYGSEAWTFTKELVERVR 77

Query: 48  V 46
           V
Sbjct: 78  V 78


>AF519108-1|AAM74222.1|  909|Caenorhabditis elegans EOR-1 protein.
          Length = 909

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = -3

Query: 429 DQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN-TTPLKLQDCGFEVSTEVYIS 265
           ++M + L+D  +  E+ G     + T+D  V S N   P   +DCGF   T  ++S
Sbjct: 528 ERMHSVLDDRSLHCEECGRGFQQHSTLDHHVASHNDPRPYICEDCGFATKTADHLS 583


>AF502568-1|AAM74151.1|  909|Caenorhabditis elegans EOR-1 protein.
          Length = 909

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = -3

Query: 429 DQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN-TTPLKLQDCGFEVSTEVYIS 265
           ++M + L+D  +  E+ G     + T+D  V S N   P   +DCGF   T  ++S
Sbjct: 528 ERMHSVLDDRSLHCEECGRGFQQHSTLDHHVASHNDPRPYICEDCGFATKTADHLS 583


>AF100669-8|AAK39268.1|  909|Caenorhabditis elegans Egl-1
           suppressor/dio uptake defective/raf enhancer protein 1
           protein.
          Length = 909

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = -3

Query: 429 DQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN-TTPLKLQDCGFEVSTEVYIS 265
           ++M + L+D  +  E+ G     + T+D  V S N   P   +DCGF   T  ++S
Sbjct: 528 ERMHSVLDDRSLHCEECGRGFQQHSTLDHHVASHNDPRPYICEDCGFATKTADHLS 583


>AL132952-19|CAB63382.2| 1677|Caenorhabditis elegans Hypothetical
           protein Y51H4A.12 protein.
          Length = 1677

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = -2

Query: 235 GRRYRDTN*ESQGCFRAVETSLGVKCHDSSDQADPVRLHCQECSPFR 95
           G   ++++ ES+G   A E S  ++CH   D  D   + C+ C  ++
Sbjct: 804 GANAKNSDSESEGIDEAAEESWTMRCHCGMDHGDGDTIECEGCKTWQ 850


>AF038614-10|AAB92063.1| 1655|Caenorhabditis elegans Hypothetical
           protein F15E6.1 protein.
          Length = 1655

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = -2

Query: 235 GRRYRDTN*ESQGCFRAVETSLGVKCHDSSDQADPVRLHCQECSPFR 95
           G   ++++ ES+G   A E S  ++CH   D  D   + C+ C  ++
Sbjct: 796 GANAKNSDSESEGIDEAAEESWTMRCHCGMDHGDGDTIECEGCKTWQ 842


>U58738-4|AAB00604.1|  358|Caenorhabditis elegans Hypothetical
           protein F31A9.6 protein.
          Length = 358

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = -1

Query: 638 RVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           RV   Q L +    T GV QG +LSPLLF + ++DI
Sbjct: 60  RVRIGQTLSSRKFATCGVPQGAVLSPLLFGIYVNDI 95


>Z29561-4|CAD91697.1|  498|Caenorhabditis elegans Hypothetical
           protein R10E12.1d protein.
          Length = 498

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 8/100 (8%)
 Frame = -3

Query: 447 LMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYI 268
           ++T   DQ+ A    + ISA +  +        D   +  +   L L D  FE +  ++ 
Sbjct: 69  VLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFN 128

Query: 267 SGELLSNQGGSDE---DIEIRI-----RKARGAFAQLKPV 172
            G L+S  G + +   D EI++     +++ G FA+L+ V
Sbjct: 129 IGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDV 168


>Z29561-3|CAD54153.1|  846|Caenorhabditis elegans Hypothetical
           protein R10E12.1c protein.
          Length = 846

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 8/100 (8%)
 Frame = -3

Query: 447 LMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYI 268
           ++T   DQ+ A    + ISA +  +        D   +  +   L L D  FE +  ++ 
Sbjct: 69  VLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFN 128

Query: 267 SGELLSNQGGSDE---DIEIRI-----RKARGAFAQLKPV 172
            G L+S  G + +   D EI++     +++ G FA+L+ V
Sbjct: 129 IGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDV 168


>Z29561-2|CAD54152.1|  882|Caenorhabditis elegans Hypothetical
           protein R10E12.1b protein.
          Length = 882

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 8/100 (8%)
 Frame = -3

Query: 447 LMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYI 268
           ++T   DQ+ A    + ISA +  +        D   +  +   L L D  FE +  ++ 
Sbjct: 69  VLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFN 128

Query: 267 SGELLSNQGGSDE---DIEIRI-----RKARGAFAQLKPV 172
            G L+S  G + +   D EI++     +++ G FA+L+ V
Sbjct: 129 IGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDV 168


>Z29561-1|CAA82667.2|  861|Caenorhabditis elegans Hypothetical
           protein R10E12.1a protein.
          Length = 861

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 8/100 (8%)
 Frame = -3

Query: 447 LMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYI 268
           ++T   DQ+ A    + ISA +  +        D   +  +   L L D  FE +  ++ 
Sbjct: 69  VLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFN 128

Query: 267 SGELLSNQGGSDE---DIEIRI-----RKARGAFAQLKPV 172
            G L+S  G + +   D EI++     +++ G FA+L+ V
Sbjct: 129 IGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDV 168


>U73679-1|AAC67305.1|  861|Caenorhabditis elegans YNK1-a protein.
          Length = 861

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 8/100 (8%)
 Frame = -3

Query: 447 LMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYI 268
           ++T   DQ+ A    + ISA +  +        D   +  +   L L D  FE +  ++ 
Sbjct: 69  VLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFN 128

Query: 267 SGELLSNQGGSDE---DIEIRI-----RKARGAFAQLKPV 172
            G L+S  G + +   D EI++     +++ G FA+L+ V
Sbjct: 129 IGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDV 168


>L07144-12|AAM54162.1| 1053|Caenorhabditis elegans Hypothetical
            protein R05D3.1 protein.
          Length = 1053

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = -3

Query: 429  DQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEV 286
            ++ +AKL  + +  +   + + TN T+++R M +N    KLQ+ GF V
Sbjct: 934  EECEAKL--IYVENQLNFIEMVTNGTIEIRSMGRNQLEEKLQEMGFRV 979


>Z99710-9|CAN99658.1|  402|Caenorhabditis elegans Hypothetical
           protein F08A8.5b protein.
          Length = 402

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 2/59 (3%)
 Frame = +2

Query: 638 YMYYLCIRPGLYQ*FYLVYLFVLSRVHILLHCTVSKRFSQK-STNVRIIFS-LPIRHFV 808
           Y+ Y C+  G++   Y++    L   HIL +   +   S K   NV  + S +  RHF+
Sbjct: 7   YLMYFCLVLGIFANIYVIIKITLGSSHILEYFQKNSNLSPKCEINVNNLLSFIENRHFL 65


>AF016663-3|AAC70878.1| 1170|Caenorhabditis elegans Hypothetical
           protein F21E9.1 protein.
          Length = 1170

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 10/31 (32%), Positives = 23/31 (74%)
 Frame = -1

Query: 599 MTAGVKQGCLLSPLLFIMLLDDIMREVVTTL 507
           +++GV QG +  PLLFI+ +++++ ++  T+
Sbjct: 877 ISSGVPQGSVSGPLLFILFINNLLIDLAPTI 907


>AF100669-1|AAK39265.1|  931|Caenorhabditis elegans Hypothetical
           protein R11E3.3 protein.
          Length = 931

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 20/71 (28%), Positives = 29/71 (40%)
 Frame = -1

Query: 719 CGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLL 540
           C   ++ +GI  KI   +         R  HD        +  GV QG ++SP LF   L
Sbjct: 489 CNDLMEAQGIEPKIKLWLGNYLHKRLIRTSHDNHWSKWHTLLGGVPQGSVISPNLFTFYL 548

Query: 539 DDIMREVVTTL 507
            D+  +  T L
Sbjct: 549 KDMPTQQDTML 559


>Z54284-1|CAA91059.1| 2198|Caenorhabditis elegans Hypothetical protein
            D2085.1 protein.
          Length = 2198

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 492  SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPL 313
            SE+I     ++ D  L+TP  D  +  L+ ++    +     N     +M++++KN   L
Sbjct: 1154 SEHIENAGVHSGDATLVTPAQDMNKLTLDRIKDITFRIAEAFNVTGPFNMQLIAKN-NEL 1212

Query: 312  KLQDCGFEVS 283
            K+ +C   VS
Sbjct: 1213 KVIECNLRVS 1222


>AF003151-17|ABJ99068.1|   99|Caenorhabditis elegans Hypothetical
           protein D1007.19 protein.
          Length = 99

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +3

Query: 387 PQIYG-GLQVLLAFDPKLASSTLCHLHSQGLPRYFRSIQCPECCHHF 524
           P + G GL +LL F   +  ST C  +S     Y   +QC  CC H+
Sbjct: 2   PGLIGLGLLILLGFH--VTYSTQCDCNSS-CAIYTSPVQCVRCCTHY 45


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,380,607
Number of Sequences: 27780
Number of extensions: 456730
Number of successful extensions: 1144
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1101
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1139
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2072006206
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).