SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical pr...   183   1e-46
Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical pr...   178   2e-45
Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical p...   178   3e-45
Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical pr...   178   3e-45
X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin pr...   170   8e-43
U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory ...   170   8e-43
Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical p...   112   2e-25
Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical p...   112   2e-25
Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical pr...   100   8e-22
Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical pr...    95   4e-20
U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha ...    93   2e-19
Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical p...    93   2e-19
Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical pr...    93   2e-19
D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin...    93   2e-19
D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin...    93   2e-19
U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin M...    91   5e-19
D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin...    91   5e-19
AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensor...    91   5e-19
AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin...    91   5e-19
Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical p...    91   8e-19
AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical ...    91   8e-19
Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical pr...    87   8e-18
AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin...    87   8e-18
Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical pr...    87   1e-17
Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical p...    68   7e-12
AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin...    68   7e-12
Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical pr...    29   2.8  
AF003137-9|AAB93646.3|  883|Caenorhabditis elegans Hypothetical ...    29   3.8  
Z73098-2|CAA97331.2| 1058|Caenorhabditis elegans Hypothetical pr...    28   5.0  
AL022271-1|CAA18349.1|  919|Caenorhabditis elegans Hypothetical ...    28   5.0  

>Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical
           protein C54C6.2 protein.
          Length = 444

 Score =  183 bits (445), Expect = 1e-46
 Identities = 81/88 (92%), Positives = 86/88 (97%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEANGGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKEAEGCDC + F
Sbjct: 106 YTEGAELVDNVLDVVRKEAEGCDCLQGF 133



 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 37/44 (84%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGI   G Y G+SDLQL
Sbjct: 1   MREIVHVQAGQCGNQIGAKFWEVISDEHGIQPDGTYKGESDLQL 44



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIM++FSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPK 174


>Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical
           protein B0272.1 protein.
          Length = 444

 Score =  178 bits (434), Expect = 2e-45
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGGKYVPRA +VDLEPGTMDSVR+GPFGQ+FRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASGGKYVPRACLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDNVLDVVRKEAESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 42/44 (95%), Positives = 43/44 (97%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TGAY+GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGAYNGDSDLQL 44



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/44 (52%), Positives = 23/44 (52%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIM TFSVVPS K
Sbjct: 131 QGFQMTHSLGGGTGSGMGTLLISKIREEYPDRIMMTFSVVPSPK 174


>Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical
           protein K01G5.7 protein.
          Length = 449

 Score =  178 bits (433), Expect = 3e-45
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+ GKYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDV+RKEAEGCDC + F
Sbjct: 106 YTEGAELVDNVLDVIRKEAEGCDCLQGF 133



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 35/44 (79%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIG+KFWEVISDEHGI   G + G+SDLQL
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGESDLQL 44



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREE+PDRIM++FSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMSSFSVVPSPK 174


>Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical
           protein C36E8.5 protein.
          Length = 450

 Score =  178 bits (433), Expect = 3e-45
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+ GKYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDV+RKEAEGCDC + F
Sbjct: 106 YTEGAELVDNVLDVIRKEAEGCDCLQGF 133



 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 34/44 (77%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIG+KFWEVISDEHGI   G + G++DLQL
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDLQL 44



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIM++FSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPK 174


>X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin
           protein.
          Length = 441

 Score =  170 bits (413), Expect = 8e-43
 Identities = 76/88 (86%), Positives = 81/88 (92%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA   KYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDN+VFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAGSNKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKEAE  DC + F
Sbjct: 106 YTEGAELVDNVLDVVRKEAESTDCLQGF 133



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 39/44 (88%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG+KFWEVISDEHGID +G Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGSKFWEVISDEHGIDPSGQYVGDSDLQL 44



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory
           abnormality protein7 protein.
          Length = 441

 Score =  170 bits (413), Expect = 8e-43
 Identities = 76/88 (86%), Positives = 81/88 (92%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA   KYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDN+VFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAGSNKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKEAE  DC + F
Sbjct: 106 YTEGAELVDNVLDVVRKEAESTDCLQGF 133



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 39/44 (88%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG+KFWEVISDEHGID +G Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGSKFWEVISDEHGIDPSGQYVGDSDLQL 44



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score =  112 bits (269), Expect = 2e-25
 Identities = 48/88 (54%), Positives = 66/88 (75%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI  YY E  G KYVPRA++VDL+P +++ VRS  +G++F P+N V G+SGAGNNW++G+
Sbjct: 46  RITSYYKEMEGRKYVPRAILVDLDPESINYVRSTQYGKLFDPENAVSGESGAGNNWSRGY 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           Y +GAE+VD VL V+R+EAE  D    F
Sbjct: 106 YEQGAEIVDKVLSVIRREAEAADSLEGF 133



 Score = 74.1 bits (174), Expect = 8e-14
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTITKLQG 290
           M+EI+++Q GQCGNQIGAKFWE IS+EHG+   G Y GD+  QL    S   +++G
Sbjct: 1   MKEIINVQVGQCGNQIGAKFWEYISEEHGLQTDGTYKGDNGSQLERITSYYKEMEG 56



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 11/21 (52%), Positives = 18/21 (85%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           K+REEY D+ ++T S++PS+K
Sbjct: 154 KLREEYSDKTLSTCSIIPSAK 174


>Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score =  112 bits (269), Expect = 2e-25
 Identities = 48/88 (54%), Positives = 66/88 (75%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI  YY E  G KYVPRA++VDL+P +++ VRS  +G++F P+N V G+SGAGNNW++G+
Sbjct: 46  RITSYYKEMEGRKYVPRAILVDLDPESINYVRSTQYGKLFDPENAVSGESGAGNNWSRGY 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           Y +GAE+VD VL V+R+EAE  D    F
Sbjct: 106 YEQGAEIVDKVLSVIRREAEAADSLEGF 133



 Score = 74.1 bits (174), Expect = 8e-14
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTITKLQG 290
           M+EI+++Q GQCGNQIGAKFWE IS+EHG+   G Y GD+  QL    S   +++G
Sbjct: 1   MKEIINVQVGQCGNQIGAKFWEYISEEHGLQTDGTYKGDNGSQLERITSYYKEMEG 56



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 11/21 (52%), Positives = 18/21 (85%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           K+REEY D+ ++T S++PS+K
Sbjct: 154 KLREEYSDKTLSTCSIIPSAK 174


>Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical
           protein ZK899.4 protein.
          Length = 452

 Score =  100 bits (240), Expect = 8e-22
 Identities = 39/82 (47%), Positives = 59/82 (71%)
 Frame = +2

Query: 260 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 439
           +  +++E+  GK+VPRA+ VDLEP  +D +R+G +G +F PD  + G+  A NN+A+GHY
Sbjct: 52  LQAFFSESMNGKHVPRAIYVDLEPTVLDEIRNGVYGNLFHPDQIINGKEDAANNYARGHY 111

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
           T G EL+D VLD +RK+ E C+
Sbjct: 112 TIGKELIDVVLDRIRKQTENCE 133



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 17/33 (51%), Positives = 19/33 (57%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           RE V I  GQ G QIG   WE+   EHG+D  G
Sbjct: 6   RECVSIHIGQAGAQIGNACWELYCIEHGLDEAG 38


>Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical
           protein F16D3.1 protein.
          Length = 447

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 39/86 (45%), Positives = 58/86 (67%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRA+ VDLEP  +D VR+G + ++F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETPSGKHVPRAIFVDLEPTVIDEVRTGTYAKLFHPEQLISGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGCDCCRVF 520
            G EL+D V+D VR+  E C   + F
Sbjct: 110 IGKELIDVVMDRVRRLTERCQSLQGF 135



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/40 (50%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MREIV I  GQ G QIG   WE+   EHGI   G    D+
Sbjct: 1   MREIVSIHIGQAGVQIGNACWELYCLEHGITPDGLMPDDT 40


>U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha
           protein 9 protein.
          Length = 456

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 37/80 (46%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRA+MVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GHYT
Sbjct: 55  NTFFSETMAGKHVPRAIMVDLEPTPIDEIRTGTYKTLFHPEQLLTGKEDAANNYARGHYT 114

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D V+D VR+  E C
Sbjct: 115 IGKEIIDVVMDRVRRLVENC 134



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE++ I  GQ G Q+G   WE+   EHGI   G  + +  L
Sbjct: 7   REVISIHVGQAGVQMGNACWELYCLEHGIQPDGMINEEDSL 47


>Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical
           protein C47B2.3 protein.
          Length = 448

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 34/78 (43%), Positives = 57/78 (73%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GHYT G
Sbjct: 50  FFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 449 AELVDSVLDVVRKEAEGC 502
            EL+D+VLD +R+ A+ C
Sbjct: 110 KELIDTVLDRIRRLADNC 127



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical
           protein F26E4.8 protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 34/78 (43%), Positives = 57/78 (73%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GHYT G
Sbjct: 50  FFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 449 AELVDSVLDVVRKEAEGC 502
            EL+D+VLD +R+ A+ C
Sbjct: 110 KELIDTVLDRIRRLADNC 127



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE++ I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSD 39


>D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin
           protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 34/78 (43%), Positives = 57/78 (73%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GHYT G
Sbjct: 50  FFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 449 AELVDSVLDVVRKEAEGC 502
            EL+D+VLD +R+ A+ C
Sbjct: 110 KELIDTVLDRIRRLADNC 127



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE++ I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSD 39


>D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin
           protein.
          Length = 448

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 34/78 (43%), Positives = 57/78 (73%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GHYT G
Sbjct: 50  FFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 449 AELVDSVLDVVRKEAEGC 502
            EL+D+VLD +R+ A+ C
Sbjct: 110 KELIDTVLDRIRRLADNC 127



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin
           MEC-12 protein.
          Length = 450

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 35/80 (43%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D  LD +R+ A+ C
Sbjct: 110 IGKEIIDLTLDRIRRLADNC 129



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 19/42 (45%), Positives = 22/42 (52%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 42


>D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin
           protein.
          Length = 449

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 35/80 (43%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GHYT
Sbjct: 49  STFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYT 108

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D  LD +R+ A+ C
Sbjct: 109 IGKEIIDLTLDRIRRLADNC 128



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   REVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 41


>AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensory
           abnormality protein12 protein.
          Length = 450

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 35/80 (43%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D  LD +R+ A+ C
Sbjct: 110 IGKEIIDLTLDRIRRLADNC 129



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 19/42 (45%), Positives = 22/42 (52%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 42


>AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin
           (tba-3) protein.
          Length = 450

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 35/80 (43%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D  LD +R+ A+ C
Sbjct: 110 IGKEIIDLTLDRIRRLADNC 129



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 19/42 (45%), Positives = 22/42 (52%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 42


>Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 90.6 bits (215), Expect = 8e-19
 Identities = 33/78 (42%), Positives = 56/78 (71%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GHYT G
Sbjct: 50  FFSDTGNGRYVPRSIFVDLEPTVVDEIRTGNYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 449 AELVDSVLDVVRKEAEGC 502
            EL+D+ LD +R+ A+ C
Sbjct: 110 KELIDTTLDRIRRLADNC 127



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 90.6 bits (215), Expect = 8e-19
 Identities = 33/78 (42%), Positives = 56/78 (71%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GHYT G
Sbjct: 50  FFSDTGNGRYVPRSIFVDLEPTVVDEIRTGNYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 449 AELVDSVLDVVRKEAEGC 502
            EL+D+ LD +R+ A+ C
Sbjct: 110 KELIDTTLDRIRRLADNC 127



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical
           protein F32H2.9 protein.
          Length = 464

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 36/82 (43%), Positives = 56/82 (68%)
 Frame = +2

Query: 260 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 439
           IN ++ E +GGK+VPR + VDLEP  +D VR+G +  +F P+  + G+  A N +A+G Y
Sbjct: 55  INTFFAETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYARGRY 114

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
           T G E++D V+D V++ AE C+
Sbjct: 115 TIGREMIDVVMDRVKRLAENCN 136



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           RE++ I  GQ G QIG   WE+   EHGI   G +  D
Sbjct: 8   REVISIHVGQAGVQIGNACWELFCLEHGIQPDGYHVED 45


>AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin
           (tba-6) protein.
          Length = 435

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 36/82 (43%), Positives = 56/82 (68%)
 Frame = +2

Query: 260 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 439
           IN ++ E +GGK+VPR + VDLEP  +D VR+G +  +F P+  + G+  A N +A+G Y
Sbjct: 27  INTFFAETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYARGRY 86

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
           T G E++D V+D V++ AE C+
Sbjct: 87  TIGREMIDVVMDRVKRLAENCN 108


>Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical
           protein T28D6.2 protein.
          Length = 444

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 31/82 (37%), Positives = 57/82 (69%)
 Frame = +2

Query: 260 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 439
           +  ++++   G++VPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GHY
Sbjct: 46  LGTFFSDTGYGRHVPRSIFVDLEPTVVDEIRTGAYKKLFHPEQMLTGKEDAANNYARGHY 105

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
           T G E++D+ LD +R+ A  C+
Sbjct: 106 TVGKEIIDTTLDRIRRLANNCE 127



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGI 212
           MRE++ I  GQ G QIG   WE+   EHGI
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGI 30


>Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical
           protein F58A4.8 protein.
          Length = 444

 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 3/81 (3%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGP-FGQIFRPDNFVFGQ--SGAGNNWAKG 433
           ++ + +A    YVPRAV+VDLEP  ++ +   P F  +F  DN        GAGNNWA G
Sbjct: 50  DLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNWASG 109

Query: 434 HYTEGAELVDSVLDVVRKEAE 496
            Y +G E+ + ++D++ +EAE
Sbjct: 110 -YCQGQEVQEKIMDIIIREAE 129



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           ++ +  GQCGNQ+   FW+ + DEHGI+  G  + + D+
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDM 45


>AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin
           protein.
          Length = 444

 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 3/81 (3%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGP-FGQIFRPDNFVFGQ--SGAGNNWAKG 433
           ++ + +A    YVPRAV+VDLEP  ++ +   P F  +F  DN        GAGNNWA G
Sbjct: 50  DLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNWASG 109

Query: 434 HYTEGAELVDSVLDVVRKEAE 496
            Y +G E+ + ++D++ +EAE
Sbjct: 110 -YCQGQEVQEKIMDIIIREAE 129



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           ++ +  GQCGNQ+   FW+ + DEHGI+  G  + + D+
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDM 45


>Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical
           protein F28D9.1 protein.
          Length = 601

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = -2

Query: 467 PNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSP 339
           P+Q   P      SPS SP Q  RRR  P G  +++ R  RSP
Sbjct: 443 PSQSKSPAPRRRRSPSKSP-QAPRRRRSPSGSKSRSPRRRRSP 484


>AF003137-9|AAB93646.3|  883|Caenorhabditis elegans Hypothetical
           protein C27A12.9 protein.
          Length = 883

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/38 (31%), Positives = 23/38 (60%)
 Frame = +3

Query: 168 IGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTITK 281
           IG     + SD+HG+ +TG + G+S+ ++ A +   +K
Sbjct: 245 IGQTIETMKSDDHGMTSTGDHGGESENEIRAGILVHSK 282


>Z73098-2|CAA97331.2| 1058|Caenorhabditis elegans Hypothetical
           protein T21C9.2 protein.
          Length = 1058

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 425 AKGHYTEGAELVDSVLDVVRKEAEGCDCCR 514
           ++G Y +  E +++ LDV+ KE  G  C R
Sbjct: 407 SQGDYPKAIECIETSLDVLSKELNGVTCFR 436


>AL022271-1|CAA18349.1|  919|Caenorhabditis elegans Hypothetical
           protein F32F2.1 protein.
          Length = 919

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 15/62 (24%), Positives = 28/62 (45%)
 Frame = +1

Query: 79  YLIFDSGGSKFLVQS*GKSSTSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPTCSLT 258
           Y I D   SK+++Q    ++   +    +R + S          +TP VL A T  C++ 
Sbjct: 64  YRILDQNESKYILQQQSAAAIEEKKGTLLRRKSSKKLIEPLPMIITPPVLMARTQCCAVC 123

Query: 259 HQ 264
           ++
Sbjct: 124 YK 125


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,832,642
Number of Sequences: 27780
Number of extensions: 347315
Number of successful extensions: 1148
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 1068
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1143
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1434198608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).