SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0035
         (648 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr...    31   0.93 
Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p...    31   0.93 
Z77659-8|CAB01170.1|  958|Caenorhabditis elegans Hypothetical pr...    30   1.2  
Z77657-11|CAB01153.1|  958|Caenorhabditis elegans Hypothetical p...    30   1.2  
AF295093-1|AAG03081.1|  958|Caenorhabditis elegans bimC kinesin ...    30   1.2  
AB024428-1|BAC19818.1|  958|Caenorhabditis elegans kinesin like ...    30   1.2  
Z81105-5|CAB03218.2|  331|Caenorhabditis elegans Hypothetical pr...    30   1.6  
U41108-2|AAQ23121.2|  639|Caenorhabditis elegans Tropomodulin pr...    29   2.8  
U41108-1|AAQ23120.1|  308|Caenorhabditis elegans Tropomodulin pr...    29   2.8  
Z47809-1|CAA87779.1|  370|Caenorhabditis elegans Hypothetical pr...    28   5.0  
U80450-11|AAM15595.1|  664|Caenorhabditis elegans Temporarily as...    28   6.6  
U80450-9|AAK77615.1| 1112|Caenorhabditis elegans Temporarily ass...    28   6.6  
U80450-8|AAK77616.1|  949|Caenorhabditis elegans Temporarily ass...    28   6.6  
U53149-5|AAA96121.2|  427|Caenorhabditis elegans Hypothetical pr...    28   6.6  
Z74030-15|CAI79164.1|  477|Caenorhabditis elegans Hypothetical p...    27   8.7  
Z70266-1|CAB61045.1|  364|Caenorhabditis elegans Hypothetical pr...    27   8.7  
AF083646-1|AAC32857.1|  364|Caenorhabditis elegans putative pota...    27   8.7  
AF040657-2|AAB95050.2|  312|Caenorhabditis elegans Hypothetical ...    27   8.7  

>Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 26/102 (25%), Positives = 45/102 (44%)
 Frame = -3

Query: 583 KPTAANIAAIRCSSAVKYSRRRLTLGSPPTGVCWMPLIPTTAGFGSFCWPFHGLSGNSSP 404
           +PT     +   +S  + S   +T  SP T      +  +++   +   P    S ++SP
Sbjct: 427 EPTTTLTTSTASTSTTEPSTSTVTT-SPSTSPVTSTVTSSSSSSTTVTTPTSTESTSTSP 485

Query: 403 GCPLVCTILSPFTSTTQRNRAQHVGNSTFSSSMYSWHSSAFS 278
              +  +  +P TSTT  + +    +ST SSS+ S  SS  S
Sbjct: 486 SSTVTTSTTAPSTSTTGPSSSSSTPSSTASSSVSSTASSTQS 527


>Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 26/102 (25%), Positives = 45/102 (44%)
 Frame = -3

Query: 583 KPTAANIAAIRCSSAVKYSRRRLTLGSPPTGVCWMPLIPTTAGFGSFCWPFHGLSGNSSP 404
           +PT     +   +S  + S   +T  SP T      +  +++   +   P    S ++SP
Sbjct: 427 EPTTTLTTSTASTSTTEPSTSTVTT-SPSTSPVTSTVTSSSSSSTTVTTPTSTESTSTSP 485

Query: 403 GCPLVCTILSPFTSTTQRNRAQHVGNSTFSSSMYSWHSSAFS 278
              +  +  +P TSTT  + +    +ST SSS+ S  SS  S
Sbjct: 486 SSTVTTSTTAPSTSTTGPSSSSSTPSSTASSSVSSTASSTQS 527


>Z77659-8|CAB01170.1|  958|Caenorhabditis elegans Hypothetical
           protein F23B12.8 protein.
          Length = 958

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +3

Query: 444 NEPNPAVVGMSGIQQTPVGGEPRVRRLLEYLTAEEQRMAAIL 569
           ++PN   V +SG+++ PV     V +LL+ L AE++R AA L
Sbjct: 173 DDPNKKGVIVSGVEEVPVRNRSDVFKLLQ-LGAEKRRTAATL 213


>Z77657-11|CAB01153.1|  958|Caenorhabditis elegans Hypothetical
           protein F23B12.8 protein.
          Length = 958

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +3

Query: 444 NEPNPAVVGMSGIQQTPVGGEPRVRRLLEYLTAEEQRMAAIL 569
           ++PN   V +SG+++ PV     V +LL+ L AE++R AA L
Sbjct: 173 DDPNKKGVIVSGVEEVPVRNRSDVFKLLQ-LGAEKRRTAATL 213


>AF295093-1|AAG03081.1|  958|Caenorhabditis elegans bimC kinesin
           BMK-1 protein.
          Length = 958

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +3

Query: 444 NEPNPAVVGMSGIQQTPVGGEPRVRRLLEYLTAEEQRMAAIL 569
           ++PN   V +SG+++ PV     V +LL+ L AE++R AA L
Sbjct: 173 DDPNKKGVIVSGVEEVPVRNRSDVFKLLQ-LGAEKRRTAATL 213


>AB024428-1|BAC19818.1|  958|Caenorhabditis elegans kinesin like
           protein KLP-14 protein.
          Length = 958

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +3

Query: 444 NEPNPAVVGMSGIQQTPVGGEPRVRRLLEYLTAEEQRMAAIL 569
           ++PN   V +SG+++ PV     V +LL+ L AE++R AA L
Sbjct: 173 DDPNKKGVIVSGVEEVPVRNRSDVFKLLQ-LGAEKRRTAATL 213


>Z81105-5|CAB03218.2|  331|Caenorhabditis elegans Hypothetical
           protein R05D7.5 protein.
          Length = 331

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +2

Query: 536 NSRGAADGSDISSRRFIDYPAPQMQDSPRR 625
           N+ G  DGS I  RR  +  +P MQ++P R
Sbjct: 200 NAMGKLDGSFIKDRRIYNLSSPDMQNTPVR 229


>U41108-2|AAQ23121.2|  639|Caenorhabditis elegans Tropomodulin
           protein 2, isoform b protein.
          Length = 639

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +3

Query: 444 NEPNPAVVGMSGIQQTPVGGEPRVRRLLEYLTAEEQRMAAILAAVGL 584
           N+P+   + ++ +++TPV   P ++RLLE L   E      LA +GL
Sbjct: 97  NDPSLKEINLNNMKRTPV---PAIKRLLEALAYNEHCERISLANMGL 140


>U41108-1|AAQ23120.1|  308|Caenorhabditis elegans Tropomodulin
           protein 2, isoform a protein.
          Length = 308

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +3

Query: 444 NEPNPAVVGMSGIQQTPVGGEPRVRRLLEYLTAEEQRMAAILAAVGL 584
           N+P+   + ++ +++TPV   P ++RLLE L   E      LA +GL
Sbjct: 97  NDPSLKEINLNNMKRTPV---PAIKRLLEALAYNEHCERISLANMGL 140


>Z47809-1|CAA87779.1|  370|Caenorhabditis elegans Hypothetical
           protein F42A8.1 protein.
          Length = 370

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +1

Query: 121 DVSYQACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKYFIAAVD--VENQKYRKTHWN 294
           +  Y ACV    R  YQ  + W+D    + YRC   DG+     ++  + + K R+    
Sbjct: 103 EFGYSACVGTDGRT-YQKGETWTDAKNTYYYRCR-DDGRVVKTTIEGCIAHDKQRRVPLG 160

Query: 295 ATN 303
            T+
Sbjct: 161 QTD 163


>U80450-11|AAM15595.1|  664|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 163, isoform d protein.
          Length = 664

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +2

Query: 509 QGQASPGIFNSRGAADGSDISSRRFIDYPAPQMQDSPRRKRSTVY 643
           +G+A+P I       D  D +SR F   PA  MQ++  R R T +
Sbjct: 58  EGRATPSIEPDLVGRDRYDKASRCFSYVPAKSMQEAFERPRRTSF 102


>U80450-9|AAK77615.1| 1112|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 163, isoform a protein.
          Length = 1112

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +2

Query: 509 QGQASPGIFNSRGAADGSDISSRRFIDYPAPQMQDSPRRKRSTVY 643
           +G+A+P I       D  D +SR F   PA  MQ++  R R T +
Sbjct: 58  EGRATPSIEPDLVGRDRYDKASRCFSYVPAKSMQEAFERPRRTSF 102


>U80450-8|AAK77616.1|  949|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 163, isoform c protein.
          Length = 949

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +2

Query: 509 QGQASPGIFNSRGAADGSDISSRRFIDYPAPQMQDSPRRKRSTVY 643
           +G+A+P I       D  D +SR F   PA  MQ++  R R T +
Sbjct: 58  EGRATPSIEPDLVGRDRYDKASRCFSYVPAKSMQEAFERPRRTSF 102


>U53149-5|AAA96121.2|  427|Caenorhabditis elegans Hypothetical
           protein C24B5.1 protein.
          Length = 427

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = -2

Query: 371 IYFDDATQSRTARGEFDILIFDVFVAFQCVFRYFW 267
           IYF D  Q    R  +   IF+ F+A  C F   W
Sbjct: 140 IYFYDIFQDSLLRNSYYSCIFNTFLAHVCDFASVW 174


>Z74030-15|CAI79164.1|  477|Caenorhabditis elegans Hypothetical
           protein D1054.9d protein.
          Length = 477

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = +3

Query: 423 KPWKGQQNEP--NPAVVGMSGIQQTPVGGEPRVRRLLEYLTAEEQRMAAI 566
           KP + ++ EP    A V  +   +T +   P+  RLLEYL    + +AAI
Sbjct: 352 KPLRFKKPEPVDEVATVPATTSNKTSISTRPKGLRLLEYLLPNTELLAAI 401


>Z70266-1|CAB61045.1|  364|Caenorhabditis elegans Hypothetical
           protein C40C9.1 protein.
          Length = 364

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +3

Query: 210 LQMRDQRREILHS-CCGCRKPKIPEN 284
           L+ R  RR I  + CCGC KP+ P +
Sbjct: 319 LRRRSTRRSIQDTVCCGCFKPRPPRH 344


>AF083646-1|AAC32857.1|  364|Caenorhabditis elegans putative
           potassium channel subunitn2P20 protein.
          Length = 364

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +3

Query: 210 LQMRDQRREILHS-CCGCRKPKIPEN 284
           L+ R  RR I  + CCGC KP+ P +
Sbjct: 319 LRRRSTRRSIQDTVCCGCFKPRPPRH 344


>AF040657-2|AAB95050.2|  312|Caenorhabditis elegans Hypothetical
           protein T20H9.1 protein.
          Length = 312

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -2

Query: 380 SLSIYFDDATQSRTARGEFDILIFDVFVAFQCVFRYFWFSTS 255
           SLS+ FD  T+    +   D++  D F   +  F   WFST+
Sbjct: 219 SLSVEFDFFTEENAIKIRDDLMKRDTFRRCEVWFNSSWFSTA 260


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,513,924
Number of Sequences: 27780
Number of extensions: 380733
Number of successful extensions: 1150
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1094
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1150
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1434198608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).