SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0034
         (598 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81120-7|CAB03343.2|  274|Caenorhabditis elegans Hypothetical pr...    29   3.3  
AC006618-3|AAK68251.3|  960|Caenorhabditis elegans Patched relat...    27   7.7  

>Z81120-7|CAB03343.2|  274|Caenorhabditis elegans Hypothetical
           protein T12D8.3 protein.
          Length = 274

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 15/49 (30%), Positives = 22/49 (44%)
 Frame = -3

Query: 464 AWTLTSLPSRSLNLNLACWVFALLCTSTVPSKSITFTNGVWAKKTNLVG 318
           +W   S  SRS  +   C + A L TS  P       +G+W K  + +G
Sbjct: 85  SWLANSQMSRSRAMEAYCELMAQLDTSWDPDAETVKKSGLWEKMPSTMG 133


>AC006618-3|AAK68251.3|  960|Caenorhabditis elegans Patched related
           family protein 4 protein.
          Length = 960

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = -2

Query: 258 DYDSRI-YRFGSGTLKTAFDLMTTSLSNLGWKNPISAAIAS 139
           DY   I YR+     KTA + +  +L+++GW  P++ A+ S
Sbjct: 853 DYSVHICYRYHRSEYKTAQEKVADTLASVGW--PVTQAVCS 891


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,738,351
Number of Sequences: 27780
Number of extensions: 280662
Number of successful extensions: 704
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 683
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 704
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1268802960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).