SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical pr...   173   1e-43
X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin pr...   167   9e-42
U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory ...   167   9e-42
Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical p...   165   2e-41
Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical pr...   165   2e-41
Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical pr...   164   6e-41
Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical p...    95   3e-20
Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical p...    95   3e-20
Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical p...    95   4e-20
Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical pr...    95   4e-20
D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin...    95   4e-20
D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin...    95   4e-20
U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin M...    95   6e-20
D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin...    95   6e-20
AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensor...    95   6e-20
AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin...    95   6e-20
Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical pr...    92   4e-19
Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical p...    92   4e-19
AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical ...    92   4e-19
Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical pr...    89   3e-18
U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha ...    87   1e-17
Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical pr...    87   2e-17
AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin...    87   2e-17
Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical pr...    85   5e-17
AL023832-1|CAA19475.1|   85|Caenorhabditis elegans Hypothetical ...    41   0.001
Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical p...    30   1.8  
AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin...    30   1.8  
U53342-2|AAA96214.1|  272|Caenorhabditis elegans Suppressor of a...    29   2.4  
U53342-1|AAA96213.2|  371|Caenorhabditis elegans Suppressor of a...    29   3.2  
AL024499-2|CAB54260.2|  242|Caenorhabditis elegans Hypothetical ...    28   5.6  
AL024499-1|CAB54261.2|  295|Caenorhabditis elegans Hypothetical ...    28   5.6  
U00066-4|AAM54165.2|   75|Caenorhabditis elegans Hypothetical pr...    28   7.4  

>Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical
           protein B0272.1 protein.
          Length = 444

 Score =  173 bits (420), Expect = 1e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYR+LTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAMFRG 319



 Score =  163 bits (397), Expect = 8e-41
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRG+KMA+TF+GN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGVKMAATFVGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin
           protein.
          Length = 441

 Score =  167 bits (405), Expect = 9e-42
 Identities = 75/86 (87%), Positives = 78/86 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSR  QQYRA+TVPELT Q 
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSNQQYRAITVPELTQQC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLT A IFRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTAAAIFRG 319



 Score =  163 bits (396), Expect = 1e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFV+WIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSYFVDWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory
           abnormality protein7 protein.
          Length = 441

 Score =  167 bits (405), Expect = 9e-42
 Identities = 75/86 (87%), Positives = 78/86 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSR  QQYRA+TVPELT Q 
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSNQQYRAITVPELTQQC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLT A IFRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTAAAIFRG 319



 Score =  163 bits (396), Expect = 1e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFV+WIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSYFVDWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical
           protein K01G5.7 protein.
          Length = 449

 Score =  165 bits (402), Expect = 2e-41
 Identities = 74/86 (86%), Positives = 80/86 (93%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPL+++GAQ YRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGAQAYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAMFRG 319



 Score =  161 bits (392), Expect = 3e-40
 Identities = 69/85 (81%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSM+EVDEQ+ ++QNKNS+YFVEWIPNN K AVCDIPPRGLKMA+TF+GN+TAIQ +
Sbjct: 318 RGRMSMREVDEQMLSVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDLISEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQ 426


>Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical
           protein C54C6.2 protein.
          Length = 444

 Score =  165 bits (402), Expect = 2e-41
 Identities = 74/86 (86%), Positives = 80/86 (93%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPL+++GAQ YRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGAQAYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAMFRG 319



 Score =  161 bits (392), Expect = 3e-40
 Identities = 69/85 (81%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSM+EVD+Q+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMREVDDQMMNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical
           protein C36E8.5 protein.
          Length = 450

 Score =  164 bits (398), Expect = 6e-41
 Identities = 73/86 (84%), Positives = 79/86 (91%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPL+++G Q YRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAMFRG 319



 Score =  163 bits (397), Expect = 8e-41
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSM+EVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA+TF+GN+TAIQ +
Sbjct: 318 RGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDLISEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQ 426


>Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score = 95.5 bits (227), Expect = 3e-20
 Identities = 41/84 (48%), Positives = 61/84 (72%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+ + K+  EQ+ +++N++ +  +E +P +    VCDIP RGLK ++TFI N+TAIQ  
Sbjct: 316 RGQQTEKKDAEQIISVENEDPSEMIESLPKSTNTDVCDIPSRGLKTSATFIANSTAIQEP 375

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGE 504
            KR+S+QF  +FRRKAFLHWYT E
Sbjct: 376 LKRISKQFAGLFRRKAFLHWYTME 399



 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 41/92 (44%), Positives = 57/92 (61%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITT  RF G L  D+RKL  N    PRLHF+   FAP+  +G    +A ++ +LT Q+
Sbjct: 235 SGITTFQRFKGNLKTDIRKL--NTAGSPRLHFFMTSFAPVYGKGIIDCQAFSISDLTQQV 292

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KK 277
            DAKN+M  C+   G++L+ A I+RG+   KK
Sbjct: 293 LDAKNIM-TCNHNQGKFLSSAIIYRGQQTEKK 323



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 18/31 (58%), Positives = 25/31 (80%)
 Frame = +3

Query: 486 ALVHW*G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW   +E EFT+AE+ +NDLISE+QQY+
Sbjct: 391 AFLHWYTMEESEFTDAENKVNDLISEFQQYE 421


>Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score = 95.5 bits (227), Expect = 3e-20
 Identities = 41/84 (48%), Positives = 61/84 (72%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+ + K+  EQ+ +++N++ +  +E +P +    VCDIP RGLK ++TFI N+TAIQ  
Sbjct: 316 RGQQTEKKDAEQIISVENEDPSEMIESLPKSTNTDVCDIPSRGLKTSATFIANSTAIQEP 375

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGE 504
            KR+S+QF  +FRRKAFLHWYT E
Sbjct: 376 LKRISKQFAGLFRRKAFLHWYTME 399



 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 41/92 (44%), Positives = 57/92 (61%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITT  RF G L  D+RKL  N    PRLHF+   FAP+  +G    +A ++ +LT Q+
Sbjct: 235 SGITTFQRFKGNLKTDIRKL--NTAGSPRLHFFMTSFAPVYGKGIIDCQAFSISDLTQQV 292

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KK 277
            DAKN+M  C+   G++L+ A I+RG+   KK
Sbjct: 293 LDAKNIM-TCNHNQGKFLSSAIIYRGQQTEKK 323



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 18/31 (58%), Positives = 25/31 (80%)
 Frame = +3

Query: 486 ALVHW*G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW   +E EFT+AE+ +NDLISE+QQY+
Sbjct: 391 AFLHWYTMEESEFTDAENKVNDLISEFQQYE 421


>Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical
           protein C47B2.3 protein.
          Length = 448

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 42/103 (40%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    + PL S     + AL+V ++T   
Sbjct: 234 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  ++RG+ + K + +     +TK
Sbjct: 294 FEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTK 336



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          +  A   + 
Sbjct: 318 RGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLS 377

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 378 NTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEG 410


>Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical
           protein F26E4.8 protein.
          Length = 449

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 42/103 (40%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    + PL S     + AL+V ++T   
Sbjct: 234 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISADKAYHEALSVNDITNSC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  ++RG+ + K + +     +TK
Sbjct: 294 FEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTK 336



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          +  A   + 
Sbjct: 318 RGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLS 377

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 378 NTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEG 410


>D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin
           protein.
          Length = 449

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 42/103 (40%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    + PL S     + AL+V ++T   
Sbjct: 234 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISADKAYHEALSVNDITNSC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  ++RG+ + K + +     +TK
Sbjct: 294 FEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTK 336



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          +  A   + 
Sbjct: 318 RGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLS 377

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 378 NTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEG 410


>D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin
           protein.
          Length = 448

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 42/103 (40%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    + PL S     + AL+V ++T   
Sbjct: 234 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  ++RG+ + K + +     +TK
Sbjct: 294 FEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTK 336



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          +  A   + 
Sbjct: 318 RGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLS 377

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 378 NTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEG 410


>U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin
           MEC-12 protein.
          Length = 450

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 43/103 (41%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    F+P+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  +FRG+ + K + +     +TK
Sbjct: 296 FEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTK 338



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          +  A 
Sbjct: 316 CLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin
           protein.
          Length = 449

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 43/103 (41%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    F+P+ S     +  L+V E+T   
Sbjct: 235 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMC 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  +FRG+ + K + +     +TK
Sbjct: 295 FEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTK 337



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          +  A 
Sbjct: 315 CLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAV 374

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 375 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 411


>AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensory
           abnormality protein12 protein.
          Length = 450

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 43/103 (41%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    F+P+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  +FRG+ + K + +     +TK
Sbjct: 296 FEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTK 338



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          +  A 
Sbjct: 316 CLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin
           (tba-3) protein.
          Length = 450

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 43/103 (41%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    F+P+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+ V  +FRG+ + K + +     +TK
Sbjct: 296 FEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTK 338



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          +  A 
Sbjct: 316 CLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical
           protein T28D6.2 protein.
          Length = 444

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 41/103 (39%), Positives = 64/103 (62%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    + PL S    ++  L+V E+T   
Sbjct: 233 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLVAYNPLISSAHHEF--LSVDEITKSC 290

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+A N MV CDP+HG+Y+ V  ++RG+ + K +++  +  +T+
Sbjct: 291 FEASNQMVKCDPKHGKYMAVCLLYRGDVVPKDVSAAIKSIKTQ 333



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR---GLKMAST-----FIG 408
           +G +  K+V   + +I+ + S  FV+W P   K+ +   PP    G  MA        + 
Sbjct: 315 RGDVVPKDVSAAIKSIKTQRSVQFVDWCPTGFKVGLNYQPPTVIPGGDMAKVPRAVCMLS 374

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   ++R+  +F  M+ ++AF+HWY GEG
Sbjct: 375 NTTAIAEAWQRLDYKFDLMYAKRAFVHWYVGEG 407


>Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 41/103 (39%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    + PL S     + AL+V ++T   
Sbjct: 234 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLASYTPLISAEKAYHEALSVNDITNSC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPR+G+Y+ V  ++RG+ + K + +     +TK
Sbjct: 294 FEPANQMVKCDPRNGKYMAVCLLYRGDVVPKDVNTAITAIKTK 336



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +  I+ K S  FV+W P   K+ +   PP          +  A   + 
Sbjct: 318 RGDVVPKDVNTAITAIKTKRSVQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLS 377

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 378 NTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEG 410


>AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 41/103 (39%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    + PL S     + AL+V ++T   
Sbjct: 234 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLASYTPLISAEKAYHEALSVNDITNSC 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPR+G+Y+ V  ++RG+ + K + +     +TK
Sbjct: 294 FEPANQMVKCDPRNGKYMAVCLLYRGDVVPKDVNTAITAIKTK 336



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +  I+ K S  FV+W P   K+ +   PP          +  A   + 
Sbjct: 318 RGDVVPKDVNTAITAIKTKRSVQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLS 377

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 378 NTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEG 410


>Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical
           protein F16D3.1 protein.
          Length = 447

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 41/105 (39%), Positives = 62/105 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVSEITNVC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           F+  + MV CDPR+G+Y+    ++RG+ + K++ S     +TK A
Sbjct: 296 FEPGSQMVKCDPRNGKYMACCLLYRGDVVPKEINSAISTIKTKRA 340



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  KE++  ++ I+ K +  FV+W P   K+ +   PP          L+ A   + 
Sbjct: 320 RGDVVPKEINSAISTIKTKRAIQFVDWCPTGFKVGINYQPPTVVPGGDMAKLQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAIQ  + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIQEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha
           protein 9 protein.
          Length = 456

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 39/103 (37%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  +TV E+T Q 
Sbjct: 241 SSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLTTYAPIISAEKAYHEQMTVAEITQQC 300

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+    MV CDPR G+Y+    ++RG+ + K + +     +TK
Sbjct: 301 FEPGAQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIASVKTK 343



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A+++ K S  FV+W P   K+ +   PP          L+ A   + 
Sbjct: 325 RGDVVPKDVNAAIASVKTKRSIQFVDWCPTGFKVGINYQPPTVVPGADLSKLQRAVCMLS 384

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 385 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 417


>Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical
           protein F32H2.9 protein.
          Length = 464

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 41/103 (39%), Positives = 58/103 (56%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +APL S     +   TV ++T   
Sbjct: 242 SSITASLRFEGALNVDLTEFQTNLVPYPRIHFPLVTYAPLVSAERASHEQNTVSDMTHAC 301

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+    MV CDPR G+Y+ V  ++RG+ + K + S     +TK
Sbjct: 302 FEPGYQMVKCDPRRGKYMAVCLLYRGDVVPKDINSAIAAVKTK 344



 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR-------GLKMAST-FIG 408
           +G +  K+++  +A ++ K +  FVEW P   K+ +   PP        G +  S   I 
Sbjct: 326 RGDVVPKDINSAIAAVKTKRTVQFVEWCPTGFKVGINYQPPTVVPGGDLGKQTRSVCMIS 385

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 386 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 418


>AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin
           (tba-6) protein.
          Length = 435

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 41/103 (39%), Positives = 58/103 (56%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +APL S     +   TV ++T   
Sbjct: 214 SSITASLRFEGALNVDLTEFQTNLVPYPRIHFPLVTYAPLVSAERASHEQNTVSDMTHAC 273

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+    MV CDPR G+Y+ V  ++RG+ + K + S     +TK
Sbjct: 274 FEPGYQMVKCDPRRGKYMAVCLLYRGDVVPKDINSAIAAVKTK 316



 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR-------GLKMAST-FIG 408
           +G +  K+++  +A ++ K +  FVEW P   K+ +   PP        G +  S   I 
Sbjct: 298 RGDVVPKDINSAIAAVKTKRTVQFVEWCPTGFKVGINYQPPTVVPGGDLGKQTRSVCMIS 357

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 358 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 390


>Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical
           protein ZK899.4 protein.
          Length = 452

 Score = 85.0 bits (201), Expect = 5e-17
 Identities = 37/95 (38%), Positives = 56/95 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V ++T   
Sbjct: 239 SSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLATYAPVISADRAHHEPLSVQDITHMC 298

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F+  N MV CDP  G+Y+ V  ++RG+ + K + +
Sbjct: 299 FEKANQMVKCDPSAGKYMAVCLLYRGDVVPKDVNA 333



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAV---CDIPPRGLKMAST-----FIG 408
           +G +  K+V+  +++++ K    FV+W P   K+ +     I   G  +A        + 
Sbjct: 323 RGDVVPKDVNAAISSVKAKRGINFVDWCPTGFKVGINYQAPITVEGGDLAKVHRAVCMLS 382

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HW+ GEG
Sbjct: 383 NTTAIAEAWARLDHKFDLMYSKRAFVHWFVGEG 415


>AL023832-1|CAA19475.1|   85|Caenorhabditis elegans Hypothetical
           protein Y19D2B.1 protein.
          Length = 85

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +1

Query: 403 IGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           + +TTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 13  LSDTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEG 47


>Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical
           protein F58A4.8 protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/70 (25%), Positives = 31/70 (44%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDA 190
           T   RF   +   +R L  ++ PFP +HF     +P+        R  +V ++T  +   
Sbjct: 242 TAPYRFNSAMCPSIRYL--DLAPFPPMHFIQSAISPVVDPNENFTRKTSVADVTRFLLKP 299

Query: 191 KNMMVACDPR 220
            +MMV+   R
Sbjct: 300 TSMMVSTASR 309


>AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin
           protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/70 (25%), Positives = 31/70 (44%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDA 190
           T   RF   +   +R L  ++ PFP +HF     +P+        R  +V ++T  +   
Sbjct: 242 TAPYRFNSAMCPSIRYL--DLAPFPPMHFIQSAISPVVDPNENFTRKTSVADVTRFLLKP 299

Query: 191 KNMMVACDPR 220
            +MMV+   R
Sbjct: 300 TSMMVSTASR 309


>U53342-2|AAA96214.1|  272|Caenorhabditis elegans Suppressor of
           activated let-60ras protein 7, isoform a protein.
          Length = 272

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = -1

Query: 248 SSQRSNTSRVE--DHTRPSCFWRRTFAASARVQLKLDTVE 135
           SS ++  SR+E  DH   SC W + F  S +  +K+   E
Sbjct: 118 SSVKAKNSRLEKVDHVHASCEWPQGFTVSLKAYIKVGQTE 157


>U53342-1|AAA96213.2|  371|Caenorhabditis elegans Suppressor of
           activated let-60ras protein 7, isoform b protein.
          Length = 371

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = -1

Query: 248 SSQRSNTSRVE--DHTRPSCFWRRTFAASARVQLKLD 144
           SS ++  SR+E  DH   SC W + F  S +  +K++
Sbjct: 259 SSVKAKNSRLEKVDHVHASCEWPQGFTVSLKAYIKVE 295


>AL024499-2|CAB54260.2|  242|Caenorhabditis elegans Hypothetical
           protein H38K22.2b protein.
          Length = 242

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = -1

Query: 152 KLDTVELLATSAAQSQGCRNAGAETAPCSQPTSSDQRSAV 33
           K   + L A + A+S  CRN   ETA C       QRS +
Sbjct: 104 KFHELYLFAFNYAKSAACRNLDLETAICCWDVLFGQRSTI 143


>AL024499-1|CAB54261.2|  295|Caenorhabditis elegans Hypothetical
           protein H38K22.2a protein.
          Length = 295

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = -1

Query: 152 KLDTVELLATSAAQSQGCRNAGAETAPCSQPTSSDQRSAV 33
           K   + L A + A+S  CRN   ETA C       QRS +
Sbjct: 157 KFHELYLFAFNYAKSAACRNLDLETAICCWDVLFGQRSTI 196


>U00066-4|AAM54165.2|   75|Caenorhabditis elegans Hypothetical
           protein R12B2.7 protein.
          Length = 75

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +2

Query: 38  LNADLRKLAVNMVPFPRLHFY 100
           LN  L  L++N   FP+LHFY
Sbjct: 41  LNDKLISLSINAFSFPKLHFY 61


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,147,530
Number of Sequences: 27780
Number of extensions: 315776
Number of successful extensions: 1099
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1008
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1080
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1613473434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).