SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical pr...    31   0.35 
Z80789-1|CAB02551.1|  708|Caenorhabditis elegans Hypothetical pr...    31   0.61 
U41547-1|AAA83192.2|  489|Caenorhabditis elegans Glutamate recep...    29   2.5  
AF318612-1|AAK01100.1|  406|Caenorhabditis elegans ionotropic gl...    29   2.5  
U88180-1|AAB42294.1|  203|Caenorhabditis elegans Hypothetical pr...    28   3.3  
U55366-1|AAA97980.2|  430|Caenorhabditis elegans Suppressor of c...    28   3.3  
AF419335-1|AAL15971.1|  430|Caenorhabditis elegans multisubstrat...    28   3.3  
Z11126-3|CAA77474.2|  487|Caenorhabditis elegans Hypothetical pr...    27   7.6  
U13876-14|AAA21168.1| 2500|Caenorhabditis elegans Not-like (yeas...    27   10.0 

>Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical protein
            T28C6.9 protein.
          Length = 1861

 Score = 31.5 bits (68), Expect = 0.35
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = +2

Query: 218  SVSRHTQMRTAMAFEV-TLSPFPSDAPLTSMDVERALSFAPRTWHRGLQELWRLFAVVVR 394
            + +R T  R  M+  V  LS  PS    TS  +  A SF P +    LQ     F VVVR
Sbjct: 1791 AAARRTSPRVPMSSNVPALSSRPSSRMSTSSRISTASSFVPESVAVPLQSTGSAFDVVVR 1850

Query: 395  MLG 403
              G
Sbjct: 1851 QSG 1853


>Z80789-1|CAB02551.1|  708|Caenorhabditis elegans Hypothetical
           protein F48C11.2 protein.
          Length = 708

 Score = 30.7 bits (66), Expect = 0.61
 Identities = 21/86 (24%), Positives = 40/86 (46%)
 Frame = -2

Query: 327 LNARSTSILVRGASLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCR 148
           +++ +++I +  +S  +  S T+ A + L  + ++T   T A NG   S  G+  +TTC+
Sbjct: 175 VSSTTSNISLTSSSTQSYSSSTAGATSSLFTI-KVTQSTTAAGNGQGGSGSGSA-TTTCK 232

Query: 147 TARRAYSKARMACDTGGKASWLLKAW 70
            +    S    A     K+  L   W
Sbjct: 233 CSAGDVSATTAASACSEKSGCLKNQW 258


>U41547-1|AAA83192.2|  489|Caenorhabditis elegans Glutamate receptor
           family (ampa)protein 8 protein.
          Length = 489

 Score = 28.7 bits (61), Expect = 2.5
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +2

Query: 260 EVTLSPFPSDAPLTSMDVERALSFAPRTWH-RGLQELWRLFAVVV 391
           E+T++PF S     S+ V++ L   PR+W  R L  LW L ++ +
Sbjct: 165 EMTVTPFESIWVFFSIFVQQGLPEQPRSWSCRVLVALWWLASITL 209


>AF318612-1|AAK01100.1|  406|Caenorhabditis elegans ionotropic
           glutamate receptor GLR-8 protein.
          Length = 406

 Score = 28.7 bits (61), Expect = 2.5
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +2

Query: 260 EVTLSPFPSDAPLTSMDVERALSFAPRTWH-RGLQELWRLFAVVV 391
           E+T++PF S     S+ V++ L   PR+W  R L  LW L ++ +
Sbjct: 157 EMTVTPFESIWVFFSIFVQQGLPEQPRSWSCRVLVALWWLASITL 201


>U88180-1|AAB42294.1|  203|Caenorhabditis elegans Hypothetical
           protein T27A3.4 protein.
          Length = 203

 Score = 28.3 bits (60), Expect = 3.3
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = -2

Query: 213 LTTASNGSDSSSRGTEYSTT--CRTARRAYSKARMACDTGGKAS 88
           ++  S G  SSSRG+ Y  T   R+++R+ S++R    +G ++S
Sbjct: 104 VSRGSKGRRSSSRGSVYGRTGRSRSSKRSRSRSRPRTRSGSRSS 147


>U55366-1|AAA97980.2|  430|Caenorhabditis elegans Suppressor of clr
           protein 1 protein.
          Length = 430

 Score = 28.3 bits (60), Expect = 3.3
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 245 TAMAFEVTLSPFPSDAPLTSMDVERALSF 331
           + +A   T SP PSD    S+DV+R L+F
Sbjct: 391 STLAATSTRSPTPSDIEYISVDVDRTLAF 419


>AF419335-1|AAL15971.1|  430|Caenorhabditis elegans multisubstrate
           adaptor proteinSOC-1 protein.
          Length = 430

 Score = 28.3 bits (60), Expect = 3.3
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 245 TAMAFEVTLSPFPSDAPLTSMDVERALSF 331
           + +A   T SP PSD    S+DV+R L+F
Sbjct: 391 STLAATSTRSPTPSDIEYISVDVDRTLAF 419


>Z11126-3|CAA77474.2|  487|Caenorhabditis elegans Hypothetical
           protein ZK643.5 protein.
          Length = 487

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
 Frame = -3

Query: 461 NEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATYA-ERSSTRA 315
           NE+ R   E+      RRH P SE ++   + +     A YA  +  T+A
Sbjct: 356 NEQKRKREEIVRKKEERRHAPVSEKKEVPTTVSTNTSSAAYANSKDKTKA 405


>U13876-14|AAA21168.1| 2500|Caenorhabditis elegans Not-like (yeast
            ccr4/not complexcomponent) protein 1 protein.
          Length = 2500

 Score = 26.6 bits (56), Expect = 10.0
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +2

Query: 227  RHTQMRTAMAFEVTLSPFPSDAPLTSMDVERALSFAPR 340
            RHT + +A A   + +P P+ AP     V RA S  P+
Sbjct: 1086 RHTPVGSAQAGSASSTPTPAAAPTNWGAVARAASVDPK 1123


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,429,690
Number of Sequences: 27780
Number of extensions: 177800
Number of successful extensions: 614
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 588
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 614
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 945973702
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).