SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL132898-6|CAC14409.1|  187|Caenorhabditis elegans Hypothetical ...    33   0.12 
AL132898-5|CAC14408.1|  316|Caenorhabditis elegans Hypothetical ...    33   0.12 
Z81567-5|CAB04588.2|  154|Caenorhabditis elegans Hypothetical pr...    30   1.4  
Z83108-2|CAB05510.1|  820|Caenorhabditis elegans Hypothetical pr...    29   3.3  
U80846-5|AAP82647.1|  825|Caenorhabditis elegans Hypothetical pr...    28   5.8  
U80846-4|AAC70889.1| 1032|Caenorhabditis elegans Hypothetical pr...    28   5.8  
U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical pr...    28   5.8  
U41535-14|AAB63404.1|  169|Caenorhabditis elegans Hypothetical p...    27   7.7  
U39644-7|AAO44908.1|  307|Caenorhabditis elegans Collagen protei...    27   7.7  

>AL132898-6|CAC14409.1|  187|Caenorhabditis elegans Hypothetical
           protein Y59A8B.9 protein.
          Length = 187

 Score = 33.5 bits (73), Expect = 0.12
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = -3

Query: 224 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPA 93
           GPA GA   +PSR     +  +P +T R P+ TP+  P + +P+
Sbjct: 14  GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPS 57


>AL132898-5|CAC14408.1|  316|Caenorhabditis elegans Hypothetical
           protein Y59A8B.7 protein.
          Length = 316

 Score = 33.5 bits (73), Expect = 0.12
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = -3

Query: 224 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPA 93
           GPA GA   +PSR     +  +P +T R P+ TP+  P + +P+
Sbjct: 143 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPS 186


>Z81567-5|CAB04588.2|  154|Caenorhabditis elegans Hypothetical
           protein K08C9.7 protein.
          Length = 154

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = -3

Query: 197 SPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69
           SPS K+F     E G   R P+G P++S Q+ +  +QP TL +
Sbjct: 107 SPSPKYFKID--ENGKISRLPTGIPTVSIQREAFMTQPTTLRK 147


>Z83108-2|CAB05510.1|  820|Caenorhabditis elegans Hypothetical
           protein F44E5.2 protein.
          Length = 820

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 1/21 (4%)
 Frame = +2

Query: 2   CGAHVFACVVNFFG-CSRLPP 61
           C  H+F C + FFG CSR  P
Sbjct: 555 CDRHIFRCSIPFFGFCSRCEP 575


>U80846-5|AAP82647.1|  825|Caenorhabditis elegans Hypothetical
           protein K06A9.1c protein.
          Length = 825

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = -3

Query: 269 NSARGRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSM-SPQKGSPA 93
           + + G  VT   GS      +  ++ S      + V PGS+    S TPS  S   G+ +
Sbjct: 145 SGSTGSTVTVVPGSSSTFASSTPIASSSSPGSTVTVAPGSSSTYGSSTPSASSSSSGTMS 204

Query: 92  SQPYTLXRN*TVAAVSS 42
           +   +     TVA VSS
Sbjct: 205 TNSGSTGSTVTVAPVSS 221


>U80846-4|AAC70889.1| 1032|Caenorhabditis elegans Hypothetical
           protein K06A9.1a protein.
          Length = 1032

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = -3

Query: 269 NSARGRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSM-SPQKGSPA 93
           + + G  VT   GS      +  ++ S      + V PGS+    S TPS  S   G+ +
Sbjct: 352 SGSTGSTVTVVPGSSSTFASSTPIASSSSPGSTVTVAPGSSSTYGSSTPSASSSSSGTMS 411

Query: 92  SQPYTLXRN*TVAAVSS 42
           +   +     TVA VSS
Sbjct: 412 TNSGSTGSTVTVAPVSS 428


>U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical
           protein K06A9.1b protein.
          Length = 2232

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = -3

Query: 269 NSARGRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSM-SPQKGSPA 93
           + + G  VT   GS      +  ++ S      + V PGS+    S TPS  S   G+ +
Sbjct: 352 SGSTGSTVTVVPGSSSTFASSTPIASSSSPGSTVTVAPGSSSTYGSSTPSASSSSSGTMS 411

Query: 92  SQPYTLXRN*TVAAVSS 42
           +   +     TVA VSS
Sbjct: 412 TNSGSTGSTVTVAPVSS 428


>U41535-14|AAB63404.1|  169|Caenorhabditis elegans Hypothetical
           protein F18A1.8 protein.
          Length = 169

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)
 Frame = -3

Query: 233 GSMGPADGALLLS---PSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPAS 90
           G+  P    L LS   P+ + FL   ++  S     SG+P ++PQK +P S
Sbjct: 101 GTGSPLSAGLSLSNPLPAGRGFLSPAIQNTSNQFTFSGSPRITPQKHTPVS 151


>U39644-7|AAO44908.1|  307|Caenorhabditis elegans Collagen protein
           171 protein.
          Length = 307

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 6/59 (10%)
 Frame = -3

Query: 239 ATGSMGPADGALLLSPSRKHFLFICVE--PGST----PRCPSGTPSMSPQKGSPASQPY 81
           A G+ GP DG      S   F F C    PG      P+ P+G P    Q G+P +  +
Sbjct: 140 APGTNGP-DGRPATQASASDFCFDCPPGPPGPAGSIGPKGPNGNPGFDGQPGAPGNNGF 197


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,849,673
Number of Sequences: 27780
Number of extensions: 290397
Number of successful extensions: 806
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 763
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 806
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1268802960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).