SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF025472-3|AAB71075.2|  843|Caenorhabditis elegans Hypothetical ...    30   0.81 
AL117199-4|CAN99722.1| 1342|Caenorhabditis elegans Hypothetical ...    29   1.9  
AL117195-32|CAB60770.3| 1342|Caenorhabditis elegans Hypothetical...    29   1.9  
U41039-3|AAK68627.2|  537|Caenorhabditis elegans Synapse defecti...    27   4.3  
Z30423-10|CAA83014.1|  216|Caenorhabditis elegans Hypothetical p...    27   5.7  
AY204174-1|AAO39178.1|  344|Caenorhabditis elegans nuclear recep...    26   10.0 
AY204173-1|AAO39177.1|  369|Caenorhabditis elegans nuclear recep...    26   10.0 
AY204172-1|AAO39176.1|  234|Caenorhabditis elegans nuclear recep...    26   10.0 
AF043694-2|AAT27251.1|  387|Caenorhabditis elegans Nuclear hormo...    26   10.0 
AF043694-1|AAC24283.1|  412|Caenorhabditis elegans Nuclear hormo...    26   10.0 

>AF025472-3|AAB71075.2|  843|Caenorhabditis elegans Hypothetical
           protein ZK250.6 protein.
          Length = 843

 Score = 29.9 bits (64), Expect = 0.81
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = +3

Query: 246 MIFKRTP*IYSLILICNLITALRLNNKTFNFKYNLKLMS 362
           ++ KR    + L L C   T+ R+NN +   KY LKLMS
Sbjct: 437 LVIKRKDGFFKLFLRCYKKTS-RINNWSIGVKYTLKLMS 474


>AL117199-4|CAN99722.1| 1342|Caenorhabditis elegans Hypothetical
            protein Y57A10A.1 protein.
          Length = 1342

 Score = 28.7 bits (61), Expect = 1.9
 Identities = 14/39 (35%), Positives = 19/39 (48%)
 Frame = +3

Query: 108  EHDQCCSRAQVEDLQEN*KNGQEHP*RHRQSGPGDRGPR 224
            E   C S  +   L EN KN    P RH+Q+G  D+  +
Sbjct: 1052 ERTSCPSSKKRPKLAENEKNAASPPTRHQQNGSKDKNEK 1090


>AL117195-32|CAB60770.3| 1342|Caenorhabditis elegans Hypothetical
            protein Y57A10A.1 protein.
          Length = 1342

 Score = 28.7 bits (61), Expect = 1.9
 Identities = 14/39 (35%), Positives = 19/39 (48%)
 Frame = +3

Query: 108  EHDQCCSRAQVEDLQEN*KNGQEHP*RHRQSGPGDRGPR 224
            E   C S  +   L EN KN    P RH+Q+G  D+  +
Sbjct: 1052 ERTSCPSSKKRPKLAENEKNAASPPTRHQQNGSKDKNEK 1090


>U41039-3|AAK68627.2|  537|Caenorhabditis elegans Synapse defective
           protein 9, isoformc protein.
          Length = 537

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = -3

Query: 106 KPAPERRRRIGSLRNSL*VYLNSNADVKTQAA 11
           KPAPE+     SL N L V  N+  ++K Q A
Sbjct: 407 KPAPEQPVNASSLHNELRVISNAICELKAQQA 438


>Z30423-10|CAA83014.1|  216|Caenorhabditis elegans Hypothetical
           protein T20G5.12 protein.
          Length = 216

 Score = 27.1 bits (57), Expect = 5.7
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = +3

Query: 75  PILRLRSGAGFEHDQCCSRAQVE 143
           P ++  +  G +H QCCS++QV+
Sbjct: 129 PEMQFCAAQGKDHSQCCSQSQVD 151


>AY204174-1|AAO39178.1|  344|Caenorhabditis elegans nuclear receptor
           NHR-64 protein.
          Length = 344

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = -1

Query: 222 EDLDRRARFDDAVTDVPAHFFNFLEDLPPGLGSS 121
           E  +R  R+     D+P  F N L  LPP L  S
Sbjct: 265 ESFERHVRYVSPYKDMPLRFANLLLLLPPMLAIS 298


>AY204173-1|AAO39177.1|  369|Caenorhabditis elegans nuclear receptor
           NHR-64 protein.
          Length = 369

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = -1

Query: 222 EDLDRRARFDDAVTDVPAHFFNFLEDLPPGLGSS 121
           E  +R  R+     D+P  F N L  LPP L  S
Sbjct: 290 ESFERHVRYVSPYKDMPLRFANLLLLLPPMLAIS 323


>AY204172-1|AAO39176.1|  234|Caenorhabditis elegans nuclear receptor
           NHR-64 protein.
          Length = 234

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = -1

Query: 222 EDLDRRARFDDAVTDVPAHFFNFLEDLPPGLGSS 121
           E  +R  R+     D+P  F N L  LPP L  S
Sbjct: 155 ESFERHVRYVSPYKDMPLRFANLLLLLPPMLAIS 188


>AF043694-2|AAT27251.1|  387|Caenorhabditis elegans Nuclear hormone
           receptor familyprotein 64, isoform b protein.
          Length = 387

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = -1

Query: 222 EDLDRRARFDDAVTDVPAHFFNFLEDLPPGLGSS 121
           E  +R  R+     D+P  F N L  LPP L  S
Sbjct: 308 ESFERHVRYVSPYKDMPLRFANLLLLLPPMLAIS 341


>AF043694-1|AAC24283.1|  412|Caenorhabditis elegans Nuclear hormone
           receptor familyprotein 64, isoform a protein.
          Length = 412

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = -1

Query: 222 EDLDRRARFDDAVTDVPAHFFNFLEDLPPGLGSS 121
           E  +R  R+     D+P  F N L  LPP L  S
Sbjct: 333 ESFERHVRYVSPYKDMPLRFANLLLLLPPMLAIS 366


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,037,143
Number of Sequences: 27780
Number of extensions: 174829
Number of successful extensions: 430
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 429
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 430
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 713998766
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).