SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0026
         (399 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin relat...    32   0.17 
AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical...    29   0.93 
AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical ...    29   0.93 
Z68298-1|CAA92598.2|  342|Caenorhabditis elegans Hypothetical pr...    26   8.7  
AF040641-1|AAB94947.2|  203|Caenorhabditis elegans Calponin prot...    26   8.7  

>AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin related.
            see also lmb-protein 1 protein.
          Length = 1067

 Score = 31.9 bits (69), Expect = 0.17
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
 Frame = +1

Query: 76   SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 180
            +C SG +G RC  C   HWGS   + G+  R   +GN
Sbjct: 973  NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009


>AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical
            protein Y64G10A.7 protein.
          Length = 1651

 Score = 29.5 bits (63), Expect = 0.93
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 3/65 (4%)
 Frame = +1

Query: 61   EHGASSCISGKRGRRC---CNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFS 231
            EH   SC+SG  G +C   C   +    D ISG       S   G +  +C    L+ + 
Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-----HCSCQPGWRGKKCNRPCLKGYF 1249

Query: 232  GRQHC 246
            GR HC
Sbjct: 1250 GR-HC 1253



 Score = 27.9 bits (59), Expect = 2.8
 Identities = 19/63 (30%), Positives = 26/63 (41%)
 Frame = +1

Query: 58   KEHGASSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFSGR 237
            KE+G   CI G  G  C  +  +G        R   +   +  RK  RC    L  +SG 
Sbjct: 1138 KENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRC--ECLPGWSG- 1194

Query: 238  QHC 246
            +HC
Sbjct: 1195 EHC 1197


>AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical
            protein Y64G10A.7 protein.
          Length = 1651

 Score = 29.5 bits (63), Expect = 0.93
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 3/65 (4%)
 Frame = +1

Query: 61   EHGASSCISGKRGRRC---CNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFS 231
            EH   SC+SG  G +C   C   +    D ISG       S   G +  +C    L+ + 
Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-----HCSCQPGWRGKKCNRPCLKGYF 1249

Query: 232  GRQHC 246
            GR HC
Sbjct: 1250 GR-HC 1253



 Score = 27.9 bits (59), Expect = 2.8
 Identities = 19/63 (30%), Positives = 26/63 (41%)
 Frame = +1

Query: 58   KEHGASSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFSGR 237
            KE+G   CI G  G  C  +  +G        R   +   +  RK  RC    L  +SG 
Sbjct: 1138 KENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRC--ECLPGWSG- 1194

Query: 238  QHC 246
            +HC
Sbjct: 1195 EHC 1197


>Z68298-1|CAA92598.2|  342|Caenorhabditis elegans Hypothetical
           protein F44D12.2 protein.
          Length = 342

 Score = 26.2 bits (55), Expect = 8.7
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = -2

Query: 125 QCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRR 27
           +CH+  +  PRLP ++  + C   FC + A  R
Sbjct: 214 ECHV-DYFNPRLPYVKSGSSCIGQFCFISATSR 245


>AF040641-1|AAB94947.2|  203|Caenorhabditis elegans Calponin protein
           2 protein.
          Length = 203

 Score = 26.2 bits (55), Expect = 8.7
 Identities = 8/30 (26%), Positives = 18/30 (60%)
 Frame = -2

Query: 146 LMESTDPQCHILQHRRPRLPLMQLEAPCSF 57
           L+E  DP C ++ +++P++    +E   +F
Sbjct: 68  LIEKLDPSCRVVYNKKPKMAFPMMENISNF 97


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,066,432
Number of Sequences: 27780
Number of extensions: 137603
Number of successful extensions: 259
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 239
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 259
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 619699724
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).