SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0020
         (598 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical pr...    29   1.9  
Z69664-1|CAA93514.1|  325|Caenorhabditis elegans Hypothetical pr...    29   2.5  
Z68114-4|CAA92159.1|  324|Caenorhabditis elegans Hypothetical pr...    28   4.4  

>Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical protein
            C06B8.7 protein.
          Length = 3118

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 5/35 (14%)
 Frame = +3

Query: 291  VPTQKTYNYVEKNKY-----DNIVVLDHSFALGMF 380
            VP+   YNY+EKN++     D + +   S+ALG+F
Sbjct: 1642 VPSYVQYNYIEKNRFINQRGDYVDMWPRSYALGVF 1676


>Z69664-1|CAA93514.1|  325|Caenorhabditis elegans Hypothetical
           protein K04D7.1 protein.
          Length = 325

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -2

Query: 528 CK*TIRDNCYTSYIQLVLFSHCNK 457
           CK TI D+C+T ++  V FS  N+
Sbjct: 144 CKYTITDDCHTDWVSTVRFSPSNR 167


>Z68114-4|CAA92159.1|  324|Caenorhabditis elegans Hypothetical
           protein F17A2.6 protein.
          Length = 324

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = -3

Query: 524 NKPFVIIVILLTFS*CCFHIVIKHYYHFC 438
           NK FV  VIL TF   CF+  I   Y +C
Sbjct: 233 NKMFVKGVILQTFLPLCFYCPISSIYFYC 261


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,706,957
Number of Sequences: 27780
Number of extensions: 212643
Number of successful extensions: 465
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 453
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 465
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1268802960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).