SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80845-1|AAK39181.1| 1217|Caenorhabditis elegans Prion-like-(q/n...    31   0.57 
U40801-4|AAO91728.1|  873|Caenorhabditis elegans Hypothetical pr...    31   0.57 
U40801-3|AAV34792.1| 1134|Caenorhabditis elegans Hypothetical pr...    31   0.57 
U50068-6|AAB37736.2| 1079|Caenorhabditis elegans Hypothetical pr...    31   1.00 
AF036703-2|AAB88557.3|  535|Caenorhabditis elegans Hypothetical ...    31   1.00 
Z81481-2|CAB03948.1|  593|Caenorhabditis elegans Hypothetical pr...    30   1.3  
U97001-5|AAB52260.3| 1592|Caenorhabditis elegans Temporarily ass...    29   3.0  
U88172-5|AAB42260.1|  483|Caenorhabditis elegans Hypothetical pr...    29   4.0  
U23484-5|AAK93844.1|  590|Caenorhabditis elegans Hypothetical pr...    28   5.3  
AY130758-5|AAN61521.1| 2693|Caenorhabditis elegans 301KDa_2 prot...    28   5.3  
AY130758-4|AAN61520.1| 2708|Caenorhabditis elegans 301KDa_1 prot...    28   5.3  
AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote...    28   5.3  
AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote...    28   5.3  
AL110478-11|CAB54347.2| 1435|Caenorhabditis elegans Hypothetical...    28   5.3  
AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical ...    28   5.3  
AL117199-2|CAB55041.1|  189|Caenorhabditis elegans Hypothetical ...    28   7.0  
AL117199-1|CAB55038.1|  189|Caenorhabditis elegans Hypothetical ...    28   7.0  

>U80845-1|AAK39181.1| 1217|Caenorhabditis elegans
            Prion-like-(q/n-rich)-domain-bearingprotein protein 15
            protein.
          Length = 1217

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 17/73 (23%), Positives = 36/73 (49%)
 Frame = +2

Query: 251  QASASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRS 430
            Q +  +Q+++ +++  + P +  N Q +      ++LQN  II+      +PP  +  + 
Sbjct: 1001 QQNIPIQHQQQQQNMMNQPMQSNNNQNMANIQNQQNLQNPPIIQQQQQQQIPPAKVAPK- 1059

Query: 431  PRTRKVETPRKTP 469
            PR R  + P + P
Sbjct: 1060 PRYRGKKNPAQEP 1072


>U40801-4|AAO91728.1|  873|Caenorhabditis elegans Hypothetical
           protein F28E10.1c protein.
          Length = 873

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +1

Query: 265 STVRRNK-KRFMLCSQEKEKHTAIAN*IKS*ELTKSEHYRSSVSNFRSSKNN*KTFASDS 441
           S +R++K K+  + S  +    ++AN +KS +LTK  H   S +    S +N KT  S S
Sbjct: 85  SNIRKSKEKKAKMSSTPRSPLMSMANSVKS-KLTKITHLGRSSNESSGSSSNIKTSQSFS 143

Query: 442 *SRNPSQ 462
             R P Q
Sbjct: 144 GIRQPKQ 150


>U40801-3|AAV34792.1| 1134|Caenorhabditis elegans Hypothetical
           protein F28E10.1a protein.
          Length = 1134

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +1

Query: 265 STVRRNK-KRFMLCSQEKEKHTAIAN*IKS*ELTKSEHYRSSVSNFRSSKNN*KTFASDS 441
           S +R++K K+  + S  +    ++AN +KS +LTK  H   S +    S +N KT  S S
Sbjct: 131 SNIRKSKEKKAKMSSTPRSPLMSMANSVKS-KLTKITHLGRSSNESSGSSSNIKTSQSFS 189

Query: 442 *SRNPSQ 462
             R P Q
Sbjct: 190 GIRQPKQ 196


>U50068-6|AAB37736.2| 1079|Caenorhabditis elegans Hypothetical
           protein C01G5.4 protein.
          Length = 1079

 Score = 30.7 bits (66), Expect = 1.00
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +3

Query: 120 LDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESK---LDDWRVPFKRL 260
           + KLQ+   DH K +G L+  V+K      +   SK   LDD+  P K L
Sbjct: 765 IKKLQNQWGDHKKDMGSLENAVAKAKYFVAMINVSKLKTLDDYSAPLKEL 814


>AF036703-2|AAB88557.3|  535|Caenorhabditis elegans Hypothetical
           protein T11F8.4 protein.
          Length = 535

 Score = 30.7 bits (66), Expect = 1.00
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 6/114 (5%)
 Frame = +2

Query: 200 KYSNRS*KQARRLEGTFQASASVQYEETK--RDSCS-VPKRKKNI---QPLPIKSKAKSL 361
           K S+R  K  R+ +G+       + +ETK  R+S   +  R+ N    + +  KSK    
Sbjct: 402 KNSDRKKKSERKKKGSKGDMILEKSKETKDHRESGRRLTDREANAVGGKSIDAKSKGNKD 461

Query: 362 QNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTLRSHKGLENKHSS*KSR 523
             Q  I    P S+ PK   KRS  T K+  P KTP  +SH   E + SS  S+
Sbjct: 462 MEQRTIMIDKPGSITPKS--KRSRTTTKI--PHKTPH-KSHLRKEKQESSANSK 510


>Z81481-2|CAB03948.1|  593|Caenorhabditis elegans Hypothetical
           protein C38D9.2 protein.
          Length = 593

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 326 QPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKT 466
           Q  PIKS   S +N N  +++F  +     + ++SP  + VETP KT
Sbjct: 240 QSSPIKSDGYSSENSNEQDSSFETTTEETPLPEKSP-PKAVETPMKT 285


>U97001-5|AAB52260.3| 1592|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 59 protein.
          Length = 1592

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%)
 Frame = +3

Query: 54  QRARHTDALQRIMISFK-HFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKL 230
           +RA HT   ++ M   + H+E+    LQD+V         L+  + KLSQ     P   L
Sbjct: 683 ERASHTAQSEQEMKQLEAHYERAQKMLQDNVEQMNVENRGLRDEIEKLSQQMAALPRGGL 742

Query: 231 DD 236
           ++
Sbjct: 743 NE 744


>U88172-5|AAB42260.1|  483|Caenorhabditis elegans Hypothetical
           protein ZK354.8 protein.
          Length = 483

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = -3

Query: 157 LPWSFTSSCNLSSFFSKCLKEIIIRCKASVWRARCSAMIM 38
           +P +F S   L +    C K I++ C A V R    A+I+
Sbjct: 368 VPDNFLSPFRLLTVVKNCTKPIVVHCSAGVGRTGTLALIL 407


>U23484-5|AAK93844.1|  590|Caenorhabditis elegans Hypothetical
           protein EEED8.16 protein.
          Length = 590

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 5/62 (8%)
 Frame = +3

Query: 108 FEKKLDKLQDDVND---HGKTLGDLKTMV--SKLSQNTVIGPESKLDDWRVPFKRLHQYS 272
           +EKK++ LQ  VND   H +T   LK  +   K++Q  +   + +LD      ++L++  
Sbjct: 529 YEKKIEDLQSQVNDLLMHFETQNKLKEQLDAGKITQEEITESQVELDSSSSSSRKLNRKK 588

Query: 273 TK 278
            K
Sbjct: 589 KK 590


>AY130758-5|AAN61521.1| 2693|Caenorhabditis elegans 301KDa_2 protein
           protein.
          Length = 2693

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 170 PQDYGEQTFTKYSNRS*KQARRLEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSK 349
           P D  E    K  +R  ++ ++ E   +   SV YE   +DS     +  +I  LP   +
Sbjct: 46  PSDESELVVVKNVSRVVEEPKKKEVKVKEQESVDYERVAKDSEPSEYKTIDIHRLPNDLQ 105

Query: 350 AKSLQNQNIIEAAF 391
           AK + ++ + + A+
Sbjct: 106 AKYIIHEELGKGAY 119


>AY130758-4|AAN61520.1| 2708|Caenorhabditis elegans 301KDa_1 protein
           protein.
          Length = 2708

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 170 PQDYGEQTFTKYSNRS*KQARRLEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSK 349
           P D  E    K  +R  ++ ++ E   +   SV YE   +DS     +  +I  LP   +
Sbjct: 46  PSDESELVVVKNVSRVVEEPKKKEVKVKEQESVDYERVAKDSEPSEYKTIDIHRLPNDLQ 105

Query: 350 AKSLQNQNIIEAAF 391
           AK + ++ + + A+
Sbjct: 106 AKYIIHEELGKGAY 119


>AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein
             protein.
          Length = 18519

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 170   PQDYGEQTFTKYSNRS*KQARRLEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSK 349
             P D  E    K  +R  ++ ++ E   +   SV YE   +DS     +  +I  LP   +
Sbjct: 15872 PSDESELVVVKNVSRVVEEPKKKEVKVKEQESVDYERVAKDSEPSEYKTIDIHRLPNDLQ 15931

Query: 350   AKSLQNQNIIEAAF 391
             AK + ++ + + A+
Sbjct: 15932 AKYIIHEELGKGAY 15945


>AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein
             protein.
          Length = 18534

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 170   PQDYGEQTFTKYSNRS*KQARRLEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSK 349
             P D  E    K  +R  ++ ++ E   +   SV YE   +DS     +  +I  LP   +
Sbjct: 15872 PSDESELVVVKNVSRVVEEPKKKEVKVKEQESVDYERVAKDSEPSEYKTIDIHRLPNDLQ 15931

Query: 350   AKSLQNQNIIEAAF 391
             AK + ++ + + A+
Sbjct: 15932 AKYIIHEELGKGAY 15945


>AL110478-11|CAB54347.2| 1435|Caenorhabditis elegans Hypothetical
           protein Y26D4A.9 protein.
          Length = 1435

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +1

Query: 310 EKEKHTAIAN*IKS*ELTKSEHYRSSVSNFRSSKNN 417
           EK+ + AI N +K+    ++E+Y+ ++ ++R SKNN
Sbjct: 267 EKKNNLAI-NIVKTDNEEETEYYKPTIESYRISKNN 301


>AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical
           protein Y48G9A.4 protein.
          Length = 1115

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +3

Query: 69  TDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQ 200
           +D LQ  MIS+++    + +L DD N   + L + + ++S+LSQ
Sbjct: 364 SDELQERMISYQNNGIDVQQLLDDSNQKTELLDENERILSQLSQ 407


>AL117199-2|CAB55041.1|  189|Caenorhabditis elegans Hypothetical
           protein Y43F11A.4 protein.
          Length = 189

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = +2

Query: 182 GEQTFTKYSNRS*KQARR--LEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSKAK 355
           GE +   ++N+   + R   LE   Q +A+  +     DSC +PK+K +     I  ++K
Sbjct: 111 GELSAAMFTNKMVMEQRMKDLEKMDQKTANNLFVAALGDSCFIPKKKVDYSKFKITKRSK 170

Query: 356 S 358
           S
Sbjct: 171 S 171


>AL117199-1|CAB55038.1|  189|Caenorhabditis elegans Hypothetical
           protein Y43F11A.1 protein.
          Length = 189

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = +2

Query: 182 GEQTFTKYSNRS*KQARR--LEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSKAK 355
           GE +   ++N+   + R   LE   Q +A+  +     DSC +PK+K +     I  ++K
Sbjct: 111 GELSAAMFTNKMVMEQRMKDLEKMDQKTANNLFVAALGDSCFIPKKKVDYSKFKITKRSK 170

Query: 356 S 358
           S
Sbjct: 171 S 171


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,665,064
Number of Sequences: 27780
Number of extensions: 265822
Number of successful extensions: 887
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 867
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 885
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1539654388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).