SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical pr...   183   1e-46
Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical pr...   178   2e-45
Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical p...   178   3e-45
Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical pr...   178   3e-45
X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin pr...   170   7e-43
U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory ...   170   7e-43
Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical p...   112   2e-25
Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical p...   112   2e-25
Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical pr...   104   6e-23
Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical pr...    98   4e-21
Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical p...    96   1e-20
Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical pr...    96   1e-20
D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin...    96   1e-20
D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin...    96   1e-20
U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha ...    96   2e-20
U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin M...    95   4e-20
D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin...    95   4e-20
AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensor...    95   4e-20
AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin...    95   4e-20
Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical p...    94   6e-20
AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical ...    94   6e-20
Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical pr...    91   7e-19
Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical pr...    90   1e-18
AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin...    90   1e-18
Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical p...    68   4e-12
AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin...    68   4e-12
Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical pr...    30   1.4  
Z73098-2|CAA97331.2| 1058|Caenorhabditis elegans Hypothetical pr...    29   2.5  
AF003137-9|AAB93646.3|  883|Caenorhabditis elegans Hypothetical ...    29   3.3  
AL022271-1|CAA18349.1|  919|Caenorhabditis elegans Hypothetical ...    27   7.7  

>Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical
           protein C54C6.2 protein.
          Length = 444

 Score =  183 bits (445), Expect = 1e-46
 Identities = 81/87 (93%), Positives = 86/87 (98%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEANGGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAEGCDCL+ F
Sbjct: 107 TEGAELVDNVLDVVRKEAEGCDCLQGF 133



 Score = 88.2 bits (209), Expect = 4e-18
 Identities = 38/45 (84%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGI   G Y G+SDLQLE
Sbjct: 1   MREIVHVQAGQCGNQIGAKFWEVISDEHGIQPDGTYKGESDLQLE 45


>Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical
           protein B0272.1 protein.
          Length = 444

 Score =  178 bits (434), Expect = 2e-45
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGGKYVPRA +VDLEPGTMDSVR+GPFGQ+FRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASGGKYVPRACLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDNVLDVVRKEAESCDCLQGF 133



 Score = 97.1 bits (231), Expect = 8e-21
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TGAY+GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGAYNGDSDLQLE 45


>Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical
           protein K01G5.7 protein.
          Length = 449

 Score =  178 bits (433), Expect = 3e-45
 Identities = 78/87 (89%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+ GKYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  IDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDV+RKEAEGCDCL+ F
Sbjct: 107 TEGAELVDNVLDVIRKEAEGCDCLQGF 133



 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 36/45 (80%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIG+KFWEVISDEHGI   G + G+SDLQLE
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGESDLQLE 45


>Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical
           protein C36E8.5 protein.
          Length = 450

 Score =  178 bits (433), Expect = 3e-45
 Identities = 78/87 (89%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+ GKYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  IDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDV+RKEAEGCDCL+ F
Sbjct: 107 TEGAELVDNVLDVIRKEAEGCDCLQGF 133



 Score = 84.2 bits (199), Expect = 6e-17
 Identities = 35/45 (77%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIG+KFWEVISDEHGI   G + G++DLQLE
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDLQLE 45


>X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin
           protein.
          Length = 441

 Score =  170 bits (413), Expect = 7e-43
 Identities = 76/87 (87%), Positives = 81/87 (93%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA   KYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDN+VFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAGSNKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAE  DCL+ F
Sbjct: 107 TEGAELVDNVLDVVRKEAESTDCLQGF 133



 Score = 91.1 bits (216), Expect = 5e-19
 Identities = 40/45 (88%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG+KFWEVISDEHGID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGSKFWEVISDEHGIDPSGQYVGDSDLQLE 45


>U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory
           abnormality protein7 protein.
          Length = 441

 Score =  170 bits (413), Expect = 7e-43
 Identities = 76/87 (87%), Positives = 81/87 (93%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA   KYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDN+VFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAGSNKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAE  DCL+ F
Sbjct: 107 TEGAELVDNVLDVVRKEAESTDCLQGF 133



 Score = 91.1 bits (216), Expect = 5e-19
 Identities = 40/45 (88%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG+KFWEVISDEHGID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGSKFWEVISDEHGIDPSGQYVGDSDLQLE 45


>Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score =  112 bits (269), Expect = 2e-25
 Identities = 48/87 (55%), Positives = 66/87 (75%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I  YY E  G KYVPRA++VDL+P +++ VRS  +G++F P+N V G+SGAGNNW++G+Y
Sbjct: 47  ITSYYKEMEGRKYVPRAILVDLDPESINYVRSTQYGKLFDPENAVSGESGAGNNWSRGYY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
            +GAE+VD VL V+R+EAE  D L  F
Sbjct: 107 EQGAEIVDKVLSVIRREAEAADSLEGF 133



 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 31/56 (55%), Positives = 41/56 (73%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTITKLQG 287
           M+EI+++Q GQCGNQIGAKFWE IS+EHG+   G Y GD+  QLE   S   +++G
Sbjct: 1   MKEIINVQVGQCGNQIGAKFWEYISEEHGLQTDGTYKGDNGSQLERITSYYKEMEG 56


>Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score =  112 bits (269), Expect = 2e-25
 Identities = 48/87 (55%), Positives = 66/87 (75%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I  YY E  G KYVPRA++VDL+P +++ VRS  +G++F P+N V G+SGAGNNW++G+Y
Sbjct: 47  ITSYYKEMEGRKYVPRAILVDLDPESINYVRSTQYGKLFDPENAVSGESGAGNNWSRGYY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
            +GAE+VD VL V+R+EAE  D L  F
Sbjct: 107 EQGAEIVDKVLSVIRREAEAADSLEGF 133



 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 31/56 (55%), Positives = 41/56 (73%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTITKLQG 287
           M+EI+++Q GQCGNQIGAKFWE IS+EHG+   G Y GD+  QLE   S   +++G
Sbjct: 1   MKEIINVQVGQCGNQIGAKFWEYISEEHGLQTDGTYKGDNGSQLERITSYYKEMEG 56


>Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical
           protein ZK899.4 protein.
          Length = 452

 Score =  104 bits (249), Expect = 6e-23
 Identities = 42/88 (47%), Positives = 63/88 (71%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S+  +++E+  GK+VPRA+ VDLEP  +D +R+G +G +F PD  + G+  A NN+A+GH
Sbjct: 51  SLQAFFSESMNGKHVPRAIYVDLEPTVLDEIRNGVYGNLFHPDQIINGKEDAANNYARGH 110

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D VLD +RK+ E C+ L+ F
Sbjct: 111 YTIGKELIDVVLDRIRKQTENCEGLQGF 138



 Score = 37.9 bits (84), Expect = 0.005
 Identities = 17/33 (51%), Positives = 19/33 (57%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           RE V I  GQ G QIG   WE+   EHG+D  G
Sbjct: 6   RECVSIHIGQAGAQIGNACWELYCIEHGLDEAG 38


>Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical
           protein F16D3.1 protein.
          Length = 447

 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 41/88 (46%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRA+ VDLEP  +D VR+G + ++F P+  + G+  A NN+A+GH
Sbjct: 48  SYNTFFSETPSGKHVPRAIFVDLEPTVIDEVRTGTYAKLFHPEQLISGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D V+D VR+  E C  L+ F
Sbjct: 108 YTIGKELIDVVMDRVRRLTERCQSLQGF 135



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 21/45 (46%), Positives = 24/45 (53%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV I  GQ G QIG   WE+   EHGI   G    D+   +E
Sbjct: 1   MREIVSIHIGQAGVQIGNACWELYCLEHGITPDGLMPDDTSYGVE 45


>Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical
           protein C47B2.3 protein.
          Length = 448

 Score = 96.3 bits (229), Expect = 1e-20
 Identities = 37/88 (42%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GH
Sbjct: 46  SFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGH 105

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D+VLD +R+ A+ C  L+ F
Sbjct: 106 YTVGKELIDTVLDRIRRLADNCSGLQGF 133



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical
           protein F26E4.8 protein.
          Length = 449

 Score = 96.3 bits (229), Expect = 1e-20
 Identities = 37/88 (42%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GH
Sbjct: 46  SFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGH 105

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D+VLD +R+ A+ C  L+ F
Sbjct: 106 YTVGKELIDTVLDRIRRLADNCSGLQGF 133



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEA 257
           MRE++ I  GQ G QIG   WE+   EHGI   G    D     E+
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGES 46


>D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin
           protein.
          Length = 449

 Score = 96.3 bits (229), Expect = 1e-20
 Identities = 37/88 (42%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GH
Sbjct: 46  SFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGH 105

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D+VLD +R+ A+ C  L+ F
Sbjct: 106 YTVGKELIDTVLDRIRRLADNCSGLQGF 133



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEA 257
           MRE++ I  GQ G QIG   WE+   EHGI   G    D     E+
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGES 46


>D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin
           protein.
          Length = 448

 Score = 96.3 bits (229), Expect = 1e-20
 Identities = 37/88 (42%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GH
Sbjct: 46  SFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGH 105

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D+VLD +R+ A+ C  L+ F
Sbjct: 106 YTVGKELIDTVLDRIRRLADNCSGLQGF 133



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha
           protein 9 protein.
          Length = 456

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 40/88 (45%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRA+MVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GH
Sbjct: 53  SFNTFFSETMAGKHVPRAIMVDLEPTPIDEIRTGTYKTLFHPEQLLTGKEDAANNYARGH 112

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D V+D VR+  E C  L+ F
Sbjct: 113 YTIGKEIIDVVMDRVRRLVENCRGLQGF 140



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           RE++ I  GQ G Q+G   WE+   EHGI   G  + +  L ++
Sbjct: 7   REVISIHVGQAGVQMGNACWELYCLEHGIQPDGMINEEDSLGVD 50


>U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin
           MEC-12 protein.
          Length = 450

 Score = 94.7 bits (225), Expect = 4e-20
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GH
Sbjct: 48  SFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D  LD +R+ A+ C  L+ F
Sbjct: 108 YTIGKEIIDLTLDRIRRLADNCTGLQGF 135



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/42 (45%), Positives = 22/42 (52%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 42


>D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin
           protein.
          Length = 449

 Score = 94.7 bits (225), Expect = 4e-20
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GH
Sbjct: 47  SFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGH 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D  LD +R+ A+ C  L+ F
Sbjct: 107 YTIGKEIIDLTLDRIRRLADNCTGLQGF 134



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   REVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 41


>AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensory
           abnormality protein12 protein.
          Length = 450

 Score = 94.7 bits (225), Expect = 4e-20
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GH
Sbjct: 48  SFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D  LD +R+ A+ C  L+ F
Sbjct: 108 YTIGKEIIDLTLDRIRRLADNCTGLQGF 135



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/42 (45%), Positives = 22/42 (52%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 42


>AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin
           (tba-3) protein.
          Length = 450

 Score = 94.7 bits (225), Expect = 4e-20
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + +++E   G++VPRAVMVDLEP  +D +R+G +  +F P+  + G+  A NN+A+GH
Sbjct: 48  SFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D  LD +R+ A+ C  L+ F
Sbjct: 108 YTIGKEIIDLTLDRIRRLADNCTGLQGF 135



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/42 (45%), Positives = 22/42 (52%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE++ I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSL 42


>Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 94.3 bits (224), Expect = 6e-20
 Identities = 36/88 (40%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GH
Sbjct: 46  SFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGNYKKLFHPEQMITGKEDAANNYARGH 105

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D+ LD +R+ A+ C  L+ F
Sbjct: 106 YTVGKELIDTTLDRIRRLADNCSGLQGF 133



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 94.3 bits (224), Expect = 6e-20
 Identities = 36/88 (40%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++++   G+YVPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GH
Sbjct: 46  SFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGNYKKLFHPEQMITGKEDAANNYARGH 105

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D+ LD +R+ A+ C  L+ F
Sbjct: 106 YTVGKELIDTTLDRIRRLADNCSGLQGF 133



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MRE++ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical
           protein T28D6.2 protein.
          Length = 444

 Score = 90.6 bits (215), Expect = 7e-19
 Identities = 34/88 (38%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S+  ++++   G++VPR++ VDLEP  +D +R+G + ++F P+  + G+  A NN+A+GH
Sbjct: 45  SLGTFFSDTGYGRHVPRSIFVDLEPTVVDEIRTGAYKKLFHPEQMLTGKEDAANNYARGH 104

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D+ LD +R+ A  C+ L+ F
Sbjct: 105 YTVGKEIIDTTLDRIRRLANNCEGLQGF 132



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGI 209
           MRE++ I  GQ G QIG   WE+   EHGI
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGI 30


>Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical
           protein F32H2.9 protein.
          Length = 464

 Score = 89.8 bits (213), Expect = 1e-18
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           +IN ++ E +GGK+VPR + VDLEP  +D VR+G +  +F P+  + G+  A N +A+G 
Sbjct: 54  TINTFFAETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYARGR 113

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D V+D V++ AE C+ L+ F
Sbjct: 114 YTIGREMIDVVMDRVKRLAENCNGLQGF 141



 Score = 37.9 bits (84), Expect = 0.005
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           RE++ I  GQ G QIG   WE+   EHGI   G +  D
Sbjct: 8   REVISIHVGQAGVQIGNACWELFCLEHGIQPDGYHVED 45


>AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin
           (tba-6) protein.
          Length = 435

 Score = 89.8 bits (213), Expect = 1e-18
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           +IN ++ E +GGK+VPR + VDLEP  +D VR+G +  +F P+  + G+  A N +A+G 
Sbjct: 26  TINTFFAETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYARGR 85

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D V+D V++ AE C+ L+ F
Sbjct: 86  YTIGREMIDVVMDRVKRLAENCNGLQGF 113


>Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical
           protein F58A4.8 protein.
          Length = 444

 Score = 68.1 bits (159), Expect = 4e-12
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGP-FGQIFRPDNFVFGQ--SGAGNNWAKG 430
           ++ + +A    YVPRAV+VDLEP  ++ +   P F  +F  DN        GAGNNWA G
Sbjct: 50  DLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNWASG 109

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCL 508
            Y +G E+ + ++D++ +EAE  + L
Sbjct: 110 -YCQGQEVQEKIMDIIIREAENTNNL 134



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           ++ +  GQCGNQ+   FW+ + DEHGI+  G  + + D+
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDM 45


>AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin
           protein.
          Length = 444

 Score = 68.1 bits (159), Expect = 4e-12
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGP-FGQIFRPDNFVFGQ--SGAGNNWAKG 430
           ++ + +A    YVPRAV+VDLEP  ++ +   P F  +F  DN        GAGNNWA G
Sbjct: 50  DLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNWASG 109

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCL 508
            Y +G E+ + ++D++ +EAE  + L
Sbjct: 110 -YCQGQEVQEKIMDIIIREAENTNNL 134



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           ++ +  GQCGNQ+   FW+ + DEHGI+  G  + + D+
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDM 45


>Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical
           protein F28D9.1 protein.
          Length = 601

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = -3

Query: 464 PNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSP 336
           P+Q   P      SPS SP Q  RRR  P G  +++ R  RSP
Sbjct: 443 PSQSKSPAPRRRRSPSKSP-QAPRRRRSPSGSKSRSPRRRRSP 484


>Z73098-2|CAA97331.2| 1058|Caenorhabditis elegans Hypothetical
           protein T21C9.2 protein.
          Length = 1058

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 422 AKGHYTEGAELVDSVLDVVRKEAEGCDCLR 511
           ++G Y +  E +++ LDV+ KE  G  C R
Sbjct: 407 SQGDYPKAIECIETSLDVLSKELNGVTCFR 436


>AF003137-9|AAB93646.3|  883|Caenorhabditis elegans Hypothetical
           protein C27A12.9 protein.
          Length = 883

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 12/38 (31%), Positives = 23/38 (60%)
 Frame = +3

Query: 165 IGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTITK 278
           IG     + SD+HG+ +TG + G+S+ ++ A +   +K
Sbjct: 245 IGQTIETMKSDDHGMTSTGDHGGESENEIRAGILVHSK 282


>AL022271-1|CAA18349.1|  919|Caenorhabditis elegans Hypothetical
           protein F32F2.1 protein.
          Length = 919

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 15/59 (25%), Positives = 26/59 (44%)
 Frame = +1

Query: 76  YLIFDSGGSKFLVQS*GKSSTSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPTCSL 252
           Y I D   SK+++Q    ++   +    +R + S          +TP VL A T  C++
Sbjct: 64  YRILDQNESKYILQQQSAAAIEEKKGTLLRRKSSKKLIEPLPMIITPPVLMARTQCCAV 122


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,357,661
Number of Sequences: 27780
Number of extensions: 315908
Number of successful extensions: 1031
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 964
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1026
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1268802960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).