SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC025721-5|AAL32251.1|  159|Caenorhabditis elegans Ribosomal pro...    57   1e-08
AC025721-4|AAK29902.1|  187|Caenorhabditis elegans Ribosomal pro...    57   1e-08
Z80789-1|CAB02551.1|  708|Caenorhabditis elegans Hypothetical pr...    29   2.4  
U55366-1|AAA97980.2|  430|Caenorhabditis elegans Suppressor of c...    29   3.2  
AF419335-1|AAL15971.1|  430|Caenorhabditis elegans multisubstrat...    29   3.2  
U88180-1|AAB42294.1|  203|Caenorhabditis elegans Hypothetical pr...    28   5.6  
M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical pr...    28   5.6  
M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical pr...    28   5.6  
AF039038-1|AAK21435.1|  877|Caenorhabditis elegans Hypothetical ...    28   5.6  
AF038614-10|AAB92063.1| 1655|Caenorhabditis elegans Hypothetical...    27   9.8  

>AC025721-5|AAL32251.1|  159|Caenorhabditis elegans Ribosomal
           protein, large subunitprotein 17, isoform b protein.
          Length = 159

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N  KSCKARGS+LRVHFKN +E AMA+R MPLR
Sbjct: 12  NSTKSCKARGSDLRVHFKNTHEAAMALRGMPLR 44


>AC025721-4|AAK29902.1|  187|Caenorhabditis elegans Ribosomal
           protein, large subunitprotein 17, isoform a protein.
          Length = 187

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N  KSCKARGS+LRVHFKN +E AMA+R MPLR
Sbjct: 12  NSTKSCKARGSDLRVHFKNTHEAAMALRGMPLR 44


>Z80789-1|CAB02551.1|  708|Caenorhabditis elegans Hypothetical
           protein F48C11.2 protein.
          Length = 708

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 21/86 (24%), Positives = 39/86 (45%)
 Frame = -2

Query: 334 LNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCR 155
           +++ +++I +  +S  +  S T+ A   L  + ++T   T A NG   S  G+  +TTC+
Sbjct: 175 VSSTTSNISLTSSSTQSYSSSTAGATSSLFTI-KVTQSTTAAGNGQGGSGSGSA-TTTCK 232

Query: 154 TARRAYSKARMACDTGGKASWLLKAW 77
            +    S    A     K+  L   W
Sbjct: 233 CSAGDVSATTAASACSEKSGCLKNQW 258


>U55366-1|AAA97980.2|  430|Caenorhabditis elegans Suppressor of clr
           protein 1 protein.
          Length = 430

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +3

Query: 273 TLSPFPSDAPLTSMDVERALSFAPRRGTA 359
           T SP PSD    S+DV+R L+F   R  A
Sbjct: 398 TRSPTPSDIEYISVDVDRTLAFKQMRRAA 426


>AF419335-1|AAL15971.1|  430|Caenorhabditis elegans multisubstrate
           adaptor proteinSOC-1 protein.
          Length = 430

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +3

Query: 273 TLSPFPSDAPLTSMDVERALSFAPRRGTA 359
           T SP PSD    S+DV+R L+F   R  A
Sbjct: 398 TRSPTPSDIEYISVDVDRTLAFKQMRRAA 426


>U88180-1|AAB42294.1|  203|Caenorhabditis elegans Hypothetical
           protein T27A3.4 protein.
          Length = 203

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = -2

Query: 220 LTTASNGSDSSSRGTEYSTT--CRTARRAYSKARMACDTGGKAS 95
           ++  S G  SSSRG+ Y  T   R+++R+ S++R    +G ++S
Sbjct: 104 VSRGSKGRRSSSRGSVYGRTGRSRSSKRSRSRSRPRTRSGSRSS 147


>M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical protein
            ZK370.4b protein.
          Length = 1353

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = +2

Query: 329  VELRSASWHRGLQELWR 379
            VE R+ASW  G+  LWR
Sbjct: 993  VETRAASWFNGMSSLWR 1009


>M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical protein
            ZK370.4a protein.
          Length = 1342

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = +2

Query: 329  VELRSASWHRGLQELWR 379
            VE R+ASW  G+  LWR
Sbjct: 982  VETRAASWFNGMSSLWR 998


>AF039038-1|AAK21435.1|  877|Caenorhabditis elegans Hypothetical
           protein K06A5.4 protein.
          Length = 877

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 16/53 (30%), Positives = 23/53 (43%)
 Frame = -1

Query: 476 NTENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRALY 318
           N+ENEK R+  E +      R     E +QR  + A  +R      E + A Y
Sbjct: 155 NSENEKERNRREREEQQTKERERRLEEEKQRRDAEAEAERRRKEEEELEEANY 207


>AF038614-10|AAB92063.1| 1655|Caenorhabditis elegans Hypothetical
            protein F15E6.1 protein.
          Length = 1655

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = -3

Query: 450  EQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRSGTET 277
            E+R  +L+GQSP F  +R       +   R R  +A++   +A+     E R+   +T
Sbjct: 1383 EERSGLLAGQSPDFSEVRAQIEEENRMKERSRKREAKK---KAVEKEKKEHRKEPKKT 1437


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,425,133
Number of Sequences: 27780
Number of extensions: 296646
Number of successful extensions: 845
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 803
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 845
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1613473434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).