SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U64601-9|AAB04578.1|  314|Caenorhabditis elegans Hypothetical pr...    30   1.1  
AF228528-1|AAF34189.1|  314|Caenorhabditis elegans calumenin-lik...    30   1.1  
Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical pr...    28   5.8  
Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical p...    28   5.8  
AF303255-1|AAG50213.1|  573|Caenorhabditis elegans putative guan...    28   5.8  
AC024817-8|AAU05551.1|  535|Caenorhabditis elegans Hypothetical ...    28   5.8  
AC024817-7|AAK68527.1|  573|Caenorhabditis elegans Hypothetical ...    28   5.8  
AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator comp...    28   5.8  
Z81516-7|CAB04207.1| 1377|Caenorhabditis elegans Hypothetical pr...    27   7.7  
Z81467-6|CAB03874.1| 1377|Caenorhabditis elegans Hypothetical pr...    27   7.7  

>U64601-9|AAB04578.1|  314|Caenorhabditis elegans Hypothetical
           protein M03F4.7a protein.
          Length = 314

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +3

Query: 225 DIDSNGIRLLDKYSFXCEMYDEDADEIKDLTL 320
           D DSNG   LD+  + C M+ ED D ++D+ +
Sbjct: 157 DYDSNGA--LDRTEYGCFMHPEDCDHMRDVVV 186


>AF228528-1|AAF34189.1|  314|Caenorhabditis elegans calumenin-like
           protein protein.
          Length = 314

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +3

Query: 225 DIDSNGIRLLDKYSFXCEMYDEDADEIKDLTL 320
           D DSNG   LD+  + C M+ ED D ++D+ +
Sbjct: 157 DYDSNGA--LDRTEYGCFMHPEDCDHMRDVVV 186


>Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical
           protein K08F8.6 protein.
          Length = 2862

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +3

Query: 216 KQVDIDSNGIRLLDKYSFXCEMYDEDADEIKDLTL 320
           K V +D +G+RLL    F C   DED   ++ + L
Sbjct: 419 KMVLLDIDGVRLLYPSKFLCVTIDEDRQMLESIGL 453


>Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical
           protein K08F8.6 protein.
          Length = 2862

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +3

Query: 216 KQVDIDSNGIRLLDKYSFXCEMYDEDADEIKDLTL 320
           K V +D +G+RLL    F C   DED   ++ + L
Sbjct: 419 KMVLLDIDGVRLLYPSKFLCVTIDEDRQMLESIGL 453


>AF303255-1|AAG50213.1|  573|Caenorhabditis elegans putative
           guanylate-binding protein protein.
          Length = 573

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
 Frame = +1

Query: 502 SKSAKYFAMIXADSSQWTWENNPLS--SWK 585
           SK+ K    +  D+SQW   N+PLS  SW+
Sbjct: 95  SKADKVMGEVELDNSQWMSPNSPLSGFSWR 124


>AC024817-8|AAU05551.1|  535|Caenorhabditis elegans Hypothetical
           protein Y54G2A.2b protein.
          Length = 535

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
 Frame = +1

Query: 502 SKSAKYFAMIXADSSQWTWENNPLS--SWK 585
           SK+ K    +  D+SQW   N+PLS  SW+
Sbjct: 95  SKADKVMGEVELDNSQWMSPNSPLSGFSWR 124


>AC024817-7|AAK68527.1|  573|Caenorhabditis elegans Hypothetical
           protein Y54G2A.2a protein.
          Length = 573

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
 Frame = +1

Query: 502 SKSAKYFAMIXADSSQWTWENNPLS--SWK 585
           SK+ K    +  D+SQW   N+PLS  SW+
Sbjct: 95  SKADKVMGEVELDNSQWMSPNSPLSGFSWR 124


>AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator complex
           subunit Med13 protein.
          Length = 2862

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +3

Query: 216 KQVDIDSNGIRLLDKYSFXCEMYDEDADEIKDLTL 320
           K V +D +G+RLL    F C   DED   ++ + L
Sbjct: 419 KMVLLDIDGVRLLYPSKFLCVTIDEDRQMLESIGL 453


>Z81516-7|CAB04207.1| 1377|Caenorhabditis elegans Hypothetical protein
            F26H9.8 protein.
          Length = 1377

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = +3

Query: 294  ADEIKDLTLNYFPFDNSVQI-IDAKKGKNV---LKRVQLPPLNLDMLQIGNIVN 443
            ADE K +T++  P +N +QI +D+  GK V   ++ +  P  + D L I +++N
Sbjct: 1023 ADEHKIVTIDSIPVENDIQIVVDSFSGKWVELSVEELTEPKESDDELSIESLLN 1076


>Z81467-6|CAB03874.1| 1377|Caenorhabditis elegans Hypothetical protein
            F26H9.8 protein.
          Length = 1377

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = +3

Query: 294  ADEIKDLTLNYFPFDNSVQI-IDAKKGKNV---LKRVQLPPLNLDMLQIGNIVN 443
            ADE K +T++  P +N +QI +D+  GK V   ++ +  P  + D L I +++N
Sbjct: 1023 ADEHKIVTIDSIPVENDIQIVVDSFSGKWVELSVEELTEPKESDDELSIESLLN 1076


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,854,932
Number of Sequences: 27780
Number of extensions: 245888
Number of successful extensions: 633
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 619
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 633
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1268802960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).