SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0006
         (698 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U39651-6|AAL11483.1|  286|Caenorhabditis elegans Temporarily ass...    29   3.2  
U39651-5|AAL11482.2|  395|Caenorhabditis elegans Temporarily ass...    29   3.2  
U80954-3|AAK77630.1|  603|Caenorhabditis elegans Defective in ge...    27   9.8  
U80954-2|AAK77629.1|  977|Caenorhabditis elegans Defective in ge...    27   9.8  
U55363-1|AAK71420.1|  340|Caenorhabditis elegans Serpentine rece...    27   9.8  
AC024843-10|AAF60845.2|  526|Caenorhabditis elegans Hypothetical...    27   9.8  

>U39651-6|AAL11483.1|  286|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 22, isoform b protein.
          Length = 286

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +2

Query: 218 GTRRGILFRASERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDR 367
           G     L R SE +  D + S+ GI     E + H+K Q +DG+LK G+R
Sbjct: 209 GREGEFLVRDSESNPGDLSISMRGI-----ERNKHFKVQNVDGLLKIGNR 253


>U39651-5|AAL11482.2|  395|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 22, isoform a protein.
          Length = 395

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +2

Query: 218 GTRRGILFRASERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDR 367
           G     L R SE +  D + S+ GI     E + H+K Q +DG+LK G+R
Sbjct: 318 GREGEFLVRDSESNPGDLSISMRGI-----ERNKHFKVQNVDGLLKIGNR 362


>U80954-3|AAK77630.1|  603|Caenorhabditis elegans Defective in germ
           line developmentprotein 3, isoform b protein.
          Length = 603

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 217 WHKTRNSF*SIGTRSPGRGELYNGYSGREHRTS 315
           WH +  +        P RGEL +G +GR HR+S
Sbjct: 439 WHHSLPANFLKNFNMPCRGELSDGSNGRRHRSS 471


>U80954-2|AAK77629.1|  977|Caenorhabditis elegans Defective in germ
           line developmentprotein 3, isoform a protein.
          Length = 977

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 217 WHKTRNSF*SIGTRSPGRGELYNGYSGREHRTS 315
           WH +  +        P RGEL +G +GR HR+S
Sbjct: 439 WHHSLPANFLKNFNMPCRGELSDGSNGRRHRSS 471


>U55363-1|AAK71420.1|  340|Caenorhabditis elegans Serpentine
           receptor, class h protein30 protein.
          Length = 340

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = -2

Query: 334 LRLPVDVRFDVLDHYTHYRVRRVLVISFR 248
           + L V +   +L H T YR++ ++ +SFR
Sbjct: 104 MMLSVQINLGILTHITFYRMKIIIPMSFR 132


>AC024843-10|AAF60845.2|  526|Caenorhabditis elegans Hypothetical
           protein Y61A9LA.1 protein.
          Length = 526

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = -3

Query: 270 ASW*SRSDALKRIP-RLVPVFL*PKLGR 190
           A+W S +  L R+P  LVPVFL  +LGR
Sbjct: 356 ATWLSFATGLLRLPFTLVPVFLVDRLGR 383


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,895,895
Number of Sequences: 27780
Number of extensions: 252791
Number of successful extensions: 642
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 627
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 642
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1613473434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).