SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z74033-2|CAA98476.2|  419|Caenorhabditis elegans Hypothetical pr...    83   2e-16
Z74033-1|CAA98475.2|  460|Caenorhabditis elegans Hypothetical pr...    83   2e-16
Z66516-7|CAA91362.2|  494|Caenorhabditis elegans Hypothetical pr...    64   9e-11
U81043-1|AAC47486.1|  494|Caenorhabditis elegans MEX-1 protein.        64   9e-11
AL023828-30|CAA19470.2|  494|Caenorhabditis elegans Hypothetical...    64   9e-11
AL117204-11|CAB55126.1|  201|Caenorhabditis elegans Hypothetical...    59   3e-09
Z82267-3|CAB05191.1|  186|Caenorhabditis elegans Hypothetical pr...    58   5e-09
Z82286-4|CAB05310.1|  468|Caenorhabditis elegans Hypothetical pr...    58   6e-09
AL117204-8|CAB55123.1|  205|Caenorhabditis elegans Hypothetical ...    58   6e-09
U41109-13|AAB37036.1|  264|Caenorhabditis elegans Posterior segr...    58   8e-09
AB006208-1|BAA33854.1|  264|Caenorhabditis elegans cytoplasmic z...    58   8e-09
AL117204-10|CAB55125.1|  196|Caenorhabditis elegans Hypothetical...    57   1e-08
Z82261-4|CAB05147.1|  203|Caenorhabditis elegans Hypothetical pr...    55   6e-08
Z82267-5|CAB05193.1|  203|Caenorhabditis elegans Hypothetical pr...    54   7e-08
Z81521-4|CAB04229.1|  367|Caenorhabditis elegans Hypothetical pr...    54   7e-08
AL110495-2|CAB60410.1|  203|Caenorhabditis elegans Hypothetical ...    54   7e-08
Z54236-10|CAA90986.1|  407|Caenorhabditis elegans Hypothetical p...    54   1e-07
Z54235-12|CAA90977.1|  407|Caenorhabditis elegans Hypothetical p...    54   1e-07
Z48009-11|CAA88088.2|  467|Caenorhabditis elegans Hypothetical p...    54   1e-07
Z99281-15|CAB16528.1|  199|Caenorhabditis elegans Hypothetical p...    54   1e-07
U53155-1|AAC48268.1|  393|Caenorhabditis elegans Oocyte maturati...    54   1e-07
Z98866-11|CAB11564.2|  335|Caenorhabditis elegans Hypothetical p...    44   8e-05
U62896-1|AAB17868.1|  335|Caenorhabditis elegans PIE-1 protein.        44   8e-05
Z81581-5|CAB04667.2|  646|Caenorhabditis elegans Hypothetical pr...    35   0.049
Z92803-1|CAB07242.2|  384|Caenorhabditis elegans Hypothetical pr...    33   0.20 
AF304126-1|AAG50239.1|  384|Caenorhabditis elegans RING and zinc...    33   0.20 
U46674-4|AAA85756.1|  574|Caenorhabditis elegans Hypothetical pr...    32   0.45 
U29157-1|AAA68423.4|  675|Caenorhabditis elegans Hypothetical pr...    32   0.45 
Z81581-6|CAB04666.1|  679|Caenorhabditis elegans Hypothetical pr...    31   0.79 
Z81042-1|CAB02795.1| 1657|Caenorhabditis elegans Hypothetical pr...    29   4.2  
AF003143-4|AAO61427.1|  247|Caenorhabditis elegans Hypothetical ...    28   5.6  
AF003143-3|AAL65781.1|  385|Caenorhabditis elegans Hypothetical ...    28   5.6  
AF003143-2|AAK68267.2|  554|Caenorhabditis elegans Hypothetical ...    28   5.6  
Z82259-10|CAD36480.1|  439|Caenorhabditis elegans Hypothetical p...    27   9.8  
AL022473-2|CAA18549.2|  439|Caenorhabditis elegans Hypothetical ...    27   9.8  
AF332211-1|AAK17982.1|  439|Caenorhabditis elegans nuclear recep...    27   9.8  
AF039047-15|AAM15588.1| 1040|Caenorhabditis elegans Human mlk (m...    27   9.8  
AF039047-14|AAM15589.1|  978|Caenorhabditis elegans Human mlk (m...    27   9.8  
AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical ...    27   9.8  

>Z74033-2|CAA98476.2|  419|Caenorhabditis elegans Hypothetical
           protein F38B7.1b protein.
          Length = 419

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 30/44 (68%), Positives = 36/44 (81%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           CQ+AHG  E R + RHPKYKTE C++FH  G+CPYGPRCHF+HN
Sbjct: 178 CQYAHGELEKRPVPRHPKYKTEACQSFHQSGYCPYGPRCHFIHN 221



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
 Frame = +1

Query: 298 RHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           ++PK YKTELCR++   G C YG RC + H   E R
Sbjct: 153 KNPKLYKTELCRSWMDHGRCNYGERCQYAHGELEKR 188



 Score = 31.1 bits (67), Expect = 0.79
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTE C+ F ++G C YG   + +
Sbjct: 196 YKTEACQSFHQSGYCPYGPRCHFI 219



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCR + + G C YG+
Sbjct: 158 YKTELCRSWMDHGRCNYGE 176


>Z74033-1|CAA98475.2|  460|Caenorhabditis elegans Hypothetical
           protein F38B7.1a protein.
          Length = 460

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 30/44 (68%), Positives = 36/44 (81%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           CQ+AHG  E R + RHPKYKTE C++FH  G+CPYGPRCHF+HN
Sbjct: 219 CQYAHGELEKRPVPRHPKYKTEACQSFHQSGYCPYGPRCHFIHN 262



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
 Frame = +1

Query: 298 RHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           ++PK YKTELCR++   G C YG RC + H   E R
Sbjct: 194 KNPKLYKTELCRSWMDHGRCNYGERCQYAHGELEKR 229



 Score = 31.1 bits (67), Expect = 0.79
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTE C+ F ++G C YG   + +
Sbjct: 237 YKTEACQSFHQSGYCPYGPRCHFI 260



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCR + + G C YG+
Sbjct: 199 YKTELCRSWMDHGRCNYGE 217


>Z66516-7|CAA91362.2|  494|Caenorhabditis elegans Hypothetical
           protein W03C9.7 protein.
          Length = 494

 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
 Frame = +1

Query: 226 RSGGL*IWG*CQFAHGVRELRNLQR-----HPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           RSG       C+FAHG  ELR   +     HPKYKT+LC  F + G CPYGPRC F+H  
Sbjct: 149 RSGSCPYGEACRFAHGENELRMPSQPRGKAHPKYKTQLCDKFSNFGQCPYGPRCQFIHKL 208

Query: 391 EE 396
           ++
Sbjct: 209 KK 210



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R  ++   +KT LC  F   G CPYG  C F H   E R
Sbjct: 131 RQKRKEEAFKTALCDAFKRSGSCPYGEACRFAHGENELR 169



 Score = 27.9 bits (59), Expect = 7.4
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKT+LC  F   G C YG     +
Sbjct: 182 YKTQLCDKFSNFGQCPYGPRCQFI 205


>U81043-1|AAC47486.1|  494|Caenorhabditis elegans MEX-1 protein.
          Length = 494

 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
 Frame = +1

Query: 226 RSGGL*IWG*CQFAHGVRELRNLQR-----HPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           RSG       C+FAHG  ELR   +     HPKYKT+LC  F + G CPYGPRC F+H  
Sbjct: 149 RSGSCPYGEACRFAHGENELRMPSQPRGKAHPKYKTQLCDKFSNFGQCPYGPRCQFIHKL 208

Query: 391 EE 396
           ++
Sbjct: 209 KK 210



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R  ++   +KT LC  F   G CPYG  C F H   E R
Sbjct: 131 RQKRKEEAFKTALCDAFKRSGSCPYGEACRFAHGENELR 169



 Score = 27.9 bits (59), Expect = 7.4
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKT+LC  F   G C YG     +
Sbjct: 182 YKTQLCDKFSNFGQCPYGPRCQFI 205


>AL023828-30|CAA19470.2|  494|Caenorhabditis elegans Hypothetical
           protein W03C9.7 protein.
          Length = 494

 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
 Frame = +1

Query: 226 RSGGL*IWG*CQFAHGVRELRNLQR-----HPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           RSG       C+FAHG  ELR   +     HPKYKT+LC  F + G CPYGPRC F+H  
Sbjct: 149 RSGSCPYGEACRFAHGENELRMPSQPRGKAHPKYKTQLCDKFSNFGQCPYGPRCQFIHKL 208

Query: 391 EE 396
           ++
Sbjct: 209 KK 210



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R  ++   +KT LC  F   G CPYG  C F H   E R
Sbjct: 131 RQKRKEEAFKTALCDAFKRSGSCPYGEACRFAHGENELR 169



 Score = 27.9 bits (59), Expect = 7.4
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKT+LC  F   G C YG     +
Sbjct: 182 YKTQLCDKFSNFGQCPYGPRCQFI 205


>AL117204-11|CAB55126.1|  201|Caenorhabditis elegans Hypothetical
           protein Y116A8C.20 protein.
          Length = 201

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           C+FAHGV ELR  Q    H  YKT LC  F + G+C YG RC F+H + +A
Sbjct: 109 CKFAHGVHELRCQQAKKNHRNYKTVLCDKFTTTGYCKYGIRCQFIHRSMDA 159



 Score = 31.5 bits (68), Expect = 0.60
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = +1

Query: 280 ELRNLQRHP-KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           E++ ++R    +KT LC +      C YG +C F H   E R
Sbjct: 78  EMKRMKRQEGAFKTALCLSHKRGKTCIYGEQCKFAHGVHELR 119



 Score = 28.7 bits (61), Expect = 4.2
 Identities = 11/18 (61%), Positives = 11/18 (61%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKT LC  F   G CKYG
Sbjct: 130 YKTVLCDKFTTTGYCKYG 147


>Z82267-3|CAB05191.1|  186|Caenorhabditis elegans Hypothetical
           protein F38C2.5 protein.
          Length = 186

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 26/52 (50%), Positives = 31/52 (59%), Gaps = 5/52 (9%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQR-----HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C+FAH V EL+  Q+     HPKYKT LC  F   G C YG +C F+H A E
Sbjct: 93  CKFAHSVEELQLKQKNRGVNHPKYKTVLCDNFSRTGHCKYGTKCQFIHRAVE 144



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +1

Query: 280 ELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           E+  L+R    +KT LC+TF     C YG +C F H+ EE + ++
Sbjct: 62  EMMRLKRKENAFKTALCKTFQLTRACSYGEQCKFAHSVEELQLKQ 106



 Score = 28.7 bits (61), Expect = 4.2
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKT LC  F   G CKYG     +
Sbjct: 116 YKTVLCDNFSRTGHCKYGTKCQFI 139


>Z82286-4|CAB05310.1|  468|Caenorhabditis elegans Hypothetical
           protein W02A2.7 protein.
          Length = 468

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 7/54 (12%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHP--KYKTELCRTFH--SVGFCPYGPRCHFVHNAEE 396
           C+FAHG++ELR      R+P  KYKT+LC+ F     GFCPYG RC FVH  ++
Sbjct: 292 CKFAHGLKELRATDAPARYPNNKYKTKLCKNFARGGTGFCPYGLRCEFVHPTDK 345



 Score = 35.1 bits (77), Expect = 0.049
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGF--CPYGPRCHFVHNAEEAR 402
           Q+ P YKT LC   H+ G   C  G RC F H  +E R
Sbjct: 266 QQPPNYKTRLCM-MHASGIKPCDMGARCKFAHGLKELR 302


>AL117204-8|CAB55123.1|  205|Caenorhabditis elegans Hypothetical
           protein Y116A8C.17 protein.
          Length = 205

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 25/48 (52%), Positives = 30/48 (62%), Gaps = 3/48 (6%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           C+FAHGV ELR  Q    H  YKT LC  F + G+C YG RC F+H +
Sbjct: 113 CKFAHGVHELRCQQTTRNHRNYKTVLCDKFTTTGYCKYGARCQFIHRS 160



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 256 CQFAHGVRE--LRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C  +  +RE  +R  ++   +KT LC +      C YG  C F H   E R
Sbjct: 73  CTISDELREEMMRLKKKEKAFKTSLCLSHKRGKTCIYGEACKFAHGVHELR 123



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 12/27 (44%), Positives = 13/27 (48%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTAS 277
           YKT LC  F   G CKYG     +  S
Sbjct: 134 YKTVLCDKFTTTGYCKYGARCQFIHRS 160


>U41109-13|AAB37036.1|  264|Caenorhabditis elegans Posterior
           segregation protein 1 protein.
          Length = 264

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 5/48 (10%)
 Frame = +1

Query: 256 CQFAHGVRELR-----NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHGV ELR       + HPKYKT LC  F   G C YG RC F+H
Sbjct: 119 CRFAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIH 166



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 256 CQFAHGVRE--LRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C     +RE  +R  ++   +KT LC  +     C YG +C F H   E R
Sbjct: 79  CTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCRFAHGVHELR 129



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKT LC  F   G CKYG     +
Sbjct: 142 YKTVLCDKFSMTGNCKYGTRCQFI 165


>AB006208-1|BAA33854.1|  264|Caenorhabditis elegans cytoplasmic
           zinc-finger protein protein.
          Length = 264

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 5/48 (10%)
 Frame = +1

Query: 256 CQFAHGVRELR-----NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHGV ELR       + HPKYKT LC  F   G C YG RC F+H
Sbjct: 119 CRFAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIH 166



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 256 CQFAHGVRE--LRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C     +RE  +R  ++   +KT LC  +     C YG +C F H   E R
Sbjct: 79  CTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCRFAHGVHELR 129



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKT LC  F   G CKYG     +
Sbjct: 142 YKTVLCDKFSMTGNCKYGTRCQFI 165


>AL117204-10|CAB55125.1|  196|Caenorhabditis elegans Hypothetical
           protein Y116A8C.19 protein.
          Length = 196

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQR---HPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           C+FAH V ELR  Q    H  YKT LC  F + G+C YG RC F+H A
Sbjct: 104 CKFAHSVHELRFTQAKKTHRNYKTVLCDKFSTTGYCKYGARCQFIHRA 151



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +1

Query: 280 ELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           E++ L++  + +KT LC        C YG +C F H+  E R
Sbjct: 73  EMKRLKKKEEAFKTALCGFQRRGQKCIYGEQCKFAHSVHELR 114



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 11/18 (61%), Positives = 11/18 (61%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKT LC  F   G CKYG
Sbjct: 125 YKTVLCDKFSTTGYCKYG 142


>Z82261-4|CAB05147.1|  203|Caenorhabditis elegans Hypothetical
           protein C35D6.4 protein.
          Length = 203

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           C+FAH V ELR  Q    H  YKT LC  F + G C YG RC F+H + ++
Sbjct: 109 CKFAHSVHELRFPQTKRNHRNYKTVLCNNFSTTGHCKYGIRCQFIHRSMDS 159



 Score = 34.3 bits (75), Expect = 0.085
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = +1

Query: 277 RELRNLQRHPK-YKTELCRTFHSVGF-CPYGPRCHFVHNAEEAR 402
           +E+++L++  + +KT LC  FH  G  C YG +C F H+  E R
Sbjct: 77  QEMKSLKKKEEAFKTSLCG-FHRRGQKCAYGEKCKFAHSVHELR 119



 Score = 28.7 bits (61), Expect = 4.2
 Identities = 11/18 (61%), Positives = 11/18 (61%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKT LC  F   G CKYG
Sbjct: 130 YKTVLCNNFSTTGHCKYG 147


>Z82267-5|CAB05193.1|  203|Caenorhabditis elegans Hypothetical
           protein F38C2.7 protein.
          Length = 203

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           C+FAH V ELR  Q    H  YKT LC  F + G C YG RC F+H +
Sbjct: 109 CKFAHSVHELRFPQTKRNHRNYKTVLCNNFSTTGHCKYGIRCQFIHRS 156



 Score = 34.3 bits (75), Expect = 0.085
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = +1

Query: 277 RELRNLQRHPK-YKTELCRTFHSVGF-CPYGPRCHFVHNAEEAR 402
           +E+++L++  + +KT LC  FH  G  C YG +C F H+  E R
Sbjct: 77  QEMKSLKKKEEAFKTSLCG-FHRRGQKCAYGEKCKFAHSVHELR 119



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/29 (44%), Positives = 14/29 (48%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASAN 283
           YKT LC  F   G CKYG     +  S N
Sbjct: 130 YKTVLCNNFSTTGHCKYGIRCQFIHRSMN 158


>Z81521-4|CAB04229.1|  367|Caenorhabditis elegans Hypothetical
           protein F32A11.6 protein.
          Length = 367

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 4/47 (8%)
 Frame = +1

Query: 256 CQFAHGVRELR----NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHG  ELR      +++ KYKT+LC  + + G CPYG RC F+H
Sbjct: 151 CRFAHGEEELRPAKLESRQNNKYKTKLCDKYTTTGLCPYGKRCLFIH 197



 Score = 34.7 bits (76), Expect = 0.064
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R +Q+   YKT +C+ +     C +   C F H  EE R
Sbjct: 123 RRMQKPESYKTVICQAWLESKTCTFAENCRFAHGEEELR 161


>AL110495-2|CAB60410.1|  203|Caenorhabditis elegans Hypothetical
           protein Y60A9.3 protein.
          Length = 203

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           C+FAH V ELR  Q    H  YKT LC  F + G C YG RC F+H + ++
Sbjct: 109 CKFAHSVHELRFPQTKRNHRNYKTVLCNKFSTTGHCKYGIRCQFIHRSMDS 159



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGF-CPYGPRCHFVHNAEEAR 402
           R+ ++   +KT L   FH  G  C YG +C F H+  E R
Sbjct: 81  RSKKKEEAFKTSLYG-FHRRGQKCAYGEKCKFAHSVHELR 119



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 11/18 (61%), Positives = 11/18 (61%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKT LC  F   G CKYG
Sbjct: 130 YKTVLCNKFSTTGHCKYG 147


>Z54236-10|CAA90986.1|  407|Caenorhabditis elegans Hypothetical
           protein C09G9.6 protein.
          Length = 407

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 24/47 (51%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHP----KYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHG  ELR     P    KYKT+LC  + + G CPYG RC F+H
Sbjct: 133 CRFAHGEEELRPTFVEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIH 179



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 16/48 (33%), Positives = 22/48 (45%)
 Frame = +1

Query: 259 QFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           QF    R L  +Q+   YKT +C+ +     C +   C F H  EE R
Sbjct: 96  QFDPRRRGLARMQKPESYKTVICQAWLESKTCSFADNCRFAHGEEELR 143


>Z54235-12|CAA90977.1|  407|Caenorhabditis elegans Hypothetical
           protein C09G9.6 protein.
          Length = 407

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 24/47 (51%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHP----KYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHG  ELR     P    KYKT+LC  + + G CPYG RC F+H
Sbjct: 133 CRFAHGEEELRPTFVEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIH 179



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 16/48 (33%), Positives = 22/48 (45%)
 Frame = +1

Query: 259 QFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           QF    R L  +Q+   YKT +C+ +     C +   C F H  EE R
Sbjct: 96  QFDPRRRGLARMQKPESYKTVICQAWLESKTCSFADNCRFAHGEEELR 143


>Z48009-11|CAA88088.2|  467|Caenorhabditis elegans Hypothetical
           protein AH6.5 protein.
          Length = 467

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 7/53 (13%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHP--KYKTELCRTFH--SVGFCPYGPRCHFVHNAE 393
           C+FAHG++ELR      R+P  KYKT+LC+ F     G CPYG RC FVH ++
Sbjct: 295 CKFAHGLKELRASDIPTRYPNNKYKTKLCKNFARGGSGVCPYGLRCEFVHPSD 347



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 2/33 (6%)
 Frame = +1

Query: 310 YKTELCRTFHSVGF--CPYGPRCHFVHNAEEAR 402
           +KT LC T H+ G   C  G RC F H  +E R
Sbjct: 274 FKTRLCMT-HAAGINPCALGARCKFAHGLKELR 305


>Z99281-15|CAB16528.1|  199|Caenorhabditis elegans Hypothetical
           protein Y57G11C.25 protein.
          Length = 199

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 5/52 (9%)
 Frame = +1

Query: 256 CQFAHGVRELR----NLQ-RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C+FAH V EL+    NL   +PKYKT LC  F + G C YG +C F+H   E
Sbjct: 89  CKFAHSVEELQLKHQNLGINNPKYKTVLCDNFSTTGHCKYGTKCQFIHRTVE 140



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +1

Query: 256 CQFAHGVRE--LRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C  +  VRE  +R  +R   +KT LC+TF     C YG +C F H+ EE
Sbjct: 49  CTISDDVREEMMRLRRRENAFKTALCKTFQLTKACSYGEQCKFAHSVEE 97



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKT LC  F   G CKYG     +
Sbjct: 112 YKTVLCDNFSTTGHCKYGTKCQFI 135


>U53155-1|AAC48268.1|  393|Caenorhabditis elegans Oocyte maturation
           defective protein2 protein.
          Length = 393

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 22/47 (46%), Positives = 31/47 (65%), Gaps = 4/47 (8%)
 Frame = +1

Query: 256 CQFAHGVRELR----NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHG  ELR      +++ KY+T+LC  + + G CPYG RC F+H
Sbjct: 126 CRFAHGEEELRPSLIEARQNNKYRTKLCDKYTTTGLCPYGKRCLFIH 172



 Score = 34.3 bits (75), Expect = 0.085
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +1

Query: 259 QFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           Q+    R    +Q+   YKT +C+ +     C +   C F H  EE R
Sbjct: 89  QYHADPRRRHRMQKPESYKTVICQAWLESKTCAFAENCRFAHGEEELR 136


>Z98866-11|CAB11564.2|  335|Caenorhabditis elegans Hypothetical
           protein Y49E10.14 protein.
          Length = 335

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +H +YKT LC  F   G+CPY   C + H  +E R
Sbjct: 95  KHTEYKTRLCDAFRREGYCPYNDNCTYAHGQDELR 129



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           + ++C  F   G C YGPRC F+H
Sbjct: 186 RRQICHNFER-GNCRYGPRCRFIH 208



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 11/20 (55%), Positives = 11/20 (55%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDN 256
           YKT LC  F   G C Y DN
Sbjct: 99  YKTRLCDAFRREGYCPYNDN 118


>U62896-1|AAB17868.1|  335|Caenorhabditis elegans PIE-1 protein.
          Length = 335

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +H +YKT LC  F   G+CPY   C + H  +E R
Sbjct: 95  KHTEYKTRLCDAFRREGYCPYNDNCTYAHGQDELR 129



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           + ++C  F   G C YGPRC F+H
Sbjct: 186 RRQICHNFER-GNCRYGPRCRFIH 208



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 11/20 (55%), Positives = 11/20 (55%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDN 256
           YKT LC  F   G C Y DN
Sbjct: 99  YKTRLCDAFRREGYCPYNDN 118


>Z81581-5|CAB04667.2|  646|Caenorhabditis elegans Hypothetical
           protein T02E1.3a protein.
          Length = 646

 Score = 35.1 bits (77), Expect = 0.049
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           PK++T++C  +   G C YG  C + H  ++ R+
Sbjct: 35  PKFQTKICDHWRRSGSCSYGDACWYAHGEDDLRK 68



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVHN 387
           E C  F + G CP+G  CH  H+
Sbjct: 623 EPCDFFAATGSCPFGDACHQSHS 645


>Z92803-1|CAB07242.2|  384|Caenorhabditis elegans Hypothetical
           protein K01G5.1 protein.
          Length = 384

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +  ++C+ +   GFC +G  C FVH+  +
Sbjct: 176 FAPDICKDYKETGFCTFGDSCKFVHDRSD 204



 Score = 27.5 bits (58), Expect = 9.8
 Identities = 7/30 (23%), Positives = 18/30 (60%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           +  ++C+ ++E G C +GD+   +   ++Y
Sbjct: 176 FAPDICKDYKETGFCTFGDSCKFVHDRSDY 205


>AF304126-1|AAG50239.1|  384|Caenorhabditis elegans RING and zinc
           finger protein protein.
          Length = 384

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +  ++C+ +   GFC +G  C FVH+  +
Sbjct: 176 FAPDICKDYKETGFCTFGDSCKFVHDRSD 204



 Score = 27.5 bits (58), Expect = 9.8
 Identities = 7/30 (23%), Positives = 18/30 (60%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           +  ++C+ ++E G C +GD+   +   ++Y
Sbjct: 176 FAPDICKDYKETGFCTFGDSCKFVHDRSDY 205


>U46674-4|AAA85756.1|  574|Caenorhabditis elegans Hypothetical
           protein T26A8.4 protein.
          Length = 574

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = +1

Query: 304 PKYKTE--LCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           P+++TE  +C+ F   G+C  G  C + H AE++ RR
Sbjct: 162 PRFQTEHQICKFFRE-GYCRDGDNCLYSHQAEDSLRR 197


>U29157-1|AAA68423.4|  675|Caenorhabditis elegans Hypothetical
           protein C34D10.2 protein.
          Length = 675

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 1/48 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQ+ H   E    Q HP+ YK+  C      G+CP    C F H+  E
Sbjct: 262 CQYCHTRTEQ---QFHPEIYKSTKCNDMLEHGYCPRAVFCAFAHHDSE 306



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           YKTE CR       C  G  C F HN+++ RR
Sbjct: 200 YKTEQCRK--PARLCRQGYACPFYHNSKDRRR 229


>Z81581-6|CAB04666.1|  679|Caenorhabditis elegans Hypothetical
           protein T02E1.3b protein.
          Length = 679

 Score = 31.1 bits (67), Expect = 0.79
 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +1

Query: 289 NLQRHPKY-KTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           N + +P   KT++C  +   G C YG  C + H  ++ R+
Sbjct: 62  NREHNPALRKTKICDHWRRSGSCSYGDACWYAHGEDDLRK 101



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVHN 387
           E C  F + G CP+G  CH  H+
Sbjct: 656 EPCDFFAATGSCPFGDACHQSHS 678


>Z81042-1|CAB02795.1| 1657|Caenorhabditis elegans Hypothetical
           protein C27H6.1 protein.
          Length = 1657

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = +3

Query: 519 PHSPPAMSPPAQATAFAFR-RTNSPDPEDDRLPVFNRL 629
           P  PPA  PP    A A + +   P+PE+D    F R+
Sbjct: 710 PRPPPAARPPPPRPAPANKEKPKEPEPEEDAWAQFKRM 747


>AF003143-4|AAO61427.1|  247|Caenorhabditis elegans Hypothetical
           protein C53H9.2c protein.
          Length = 247

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = +2

Query: 482 GRDRHARRISIDASLSTCDVATSTGHSFRFSPHELPRSGRRP 607
           G+ RH + I ID+ L  CD       SF F   E+  +G  P
Sbjct: 162 GKTRHFQTIHIDSQLCLCDCPGLVMPSFSFGRSEMFLNGILP 203


>AF003143-3|AAL65781.1|  385|Caenorhabditis elegans Hypothetical
           protein C53H9.2b protein.
          Length = 385

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = +2

Query: 482 GRDRHARRISIDASLSTCDVATSTGHSFRFSPHELPRSGRRP 607
           G+ RH + I ID+ L  CD       SF F   E+  +G  P
Sbjct: 162 GKTRHFQTIHIDSQLCLCDCPGLVMPSFSFGRSEMFLNGILP 203


>AF003143-2|AAK68267.2|  554|Caenorhabditis elegans Hypothetical
           protein C53H9.2a protein.
          Length = 554

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = +2

Query: 482 GRDRHARRISIDASLSTCDVATSTGHSFRFSPHELPRSGRRP 607
           G+ RH + I ID+ L  CD       SF F   E+  +G  P
Sbjct: 331 GKTRHFQTIHIDSQLCLCDCPGLVMPSFSFGRSEMFLNGILP 372


>Z82259-10|CAD36480.1|  439|Caenorhabditis elegans Hypothetical
           protein H27C11.1a protein.
          Length = 439

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = +2

Query: 236 VCKYGDNANLLTASANYAIFSVILNTRRSCVALSIRLASVLMDRVAISCITQRKQD 403
           VC+YG N ++ TA  N   +         C+ + +++ +V MDR     +T+RK++
Sbjct: 71  VCRYGGNCSISTAGRNACRYCRF----HRCLFVGMKIEAVKMDRK----LTKRKKE 118


>AL022473-2|CAA18549.2|  439|Caenorhabditis elegans Hypothetical
           protein H27C11.1a protein.
          Length = 439

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = +2

Query: 236 VCKYGDNANLLTASANYAIFSVILNTRRSCVALSIRLASVLMDRVAISCITQRKQD 403
           VC+YG N ++ TA  N   +         C+ + +++ +V MDR     +T+RK++
Sbjct: 71  VCRYGGNCSISTAGRNACRYCRF----HRCLFVGMKIEAVKMDRK----LTKRKKE 118


>AF332211-1|AAK17982.1|  439|Caenorhabditis elegans nuclear receptor
           NHR-97 protein.
          Length = 439

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = +2

Query: 236 VCKYGDNANLLTASANYAIFSVILNTRRSCVALSIRLASVLMDRVAISCITQRKQD 403
           VC+YG N ++ TA  N   +         C+ + +++ +V MDR     +T+RK++
Sbjct: 71  VCRYGGNCSISTAGRNACRYCRF----HRCLFVGMKIEAVKMDRK----LTKRKKE 118


>AF039047-15|AAM15588.1| 1040|Caenorhabditis elegans Human mlk
           (mixed lineage kinase)homolog protein 1, isoform a
           protein.
          Length = 1040

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 18/59 (30%), Positives = 24/59 (40%)
 Frame = +3

Query: 156 PPVNRLLRHQPQVATRPSSADRLKKRGFVNMGIMPICSRRPRTTQSSASS*IQDGAVSH 332
           PP +R       +   P+S D +      N   MP+ SRR     SS  +   D  VSH
Sbjct: 747 PPTHRKSALDQTIPASPNSPDSIN-----NFHPMPLSSRRTTANSSSDGAPCYDALVSH 800


>AF039047-14|AAM15589.1|  978|Caenorhabditis elegans Human mlk
           (mixed lineage kinase)homolog protein 1, isoform b
           protein.
          Length = 978

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 18/59 (30%), Positives = 24/59 (40%)
 Frame = +3

Query: 156 PPVNRLLRHQPQVATRPSSADRLKKRGFVNMGIMPICSRRPRTTQSSASS*IQDGAVSH 332
           PP +R       +   P+S D +      N   MP+ SRR     SS  +   D  VSH
Sbjct: 685 PPTHRKSALDQTIPASPNSPDSIN-----NFHPMPLSSRRTTANSSSDGAPCYDALVSH 738


>AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical
           protein Y48G9A.4 protein.
          Length = 1115

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +3

Query: 462 GVVYERRVAIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSPDP 596
           G+  +++   A  AA      SPP   PPA       RR+ S DP
Sbjct: 486 GLQVQQQQQAAAAAAAAAAQKSPPTPPPPAPGPHKEQRRSTSKDP 530


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,148,572
Number of Sequences: 27780
Number of extensions: 300279
Number of successful extensions: 1190
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 1029
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1167
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1613473434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).