SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77653-1|CAB01124.1|  218|Caenorhabditis elegans Hypothetical pr...    45   5e-05
X04259-1|CAA27814.1|  161|Caenorhabditis elegans cal-1 protein.        45   5e-05
U28740-5|AAA68320.1|  229|Caenorhabditis elegans Hypothetical pr...    43   1e-04
Z82282-1|CAB05271.1|  182|Caenorhabditis elegans Hypothetical pr...    42   4e-04
Z70034-1|CAA93852.2|  171|Caenorhabditis elegans Hypothetical pr...    41   6e-04
AJ512489-1|CAD54672.1|  171|Caenorhabditis elegans calmodulin-li...    41   6e-04
L14433-5|AAA27976.2|  202|Caenorhabditis elegans Hypothetical pr...    40   0.001
U40427-2|AAA81468.2|  159|Caenorhabditis elegans Hypothetical pr...    38   0.007
U70851-8|AAB09131.1|  164|Caenorhabditis elegans Calmodulin rela...    37   0.009
U40423-5|AAA81454.2|  156|Caenorhabditis elegans Unidentified vi...    37   0.013
Z48585-7|CAA88482.1|  160|Caenorhabditis elegans Hypothetical pr...    36   0.017
AF024493-4|AAB70321.2|  249|Caenorhabditis elegans Hypothetical ...    36   0.017
AB079299-1|BAB84566.1|  160|Caenorhabditis elegans troponin C pr...    36   0.017
Z81053-2|CAB02878.2|  202|Caenorhabditis elegans Hypothetical pr...    36   0.022
Z80216-5|CAB02282.1|  190|Caenorhabditis elegans Hypothetical pr...    36   0.022
L33681-1|AAA85632.1|  190|Caenorhabditis elegans neuronal calciu...    36   0.022
U88165-10|AAK21395.1|  161|Caenorhabditis elegans Paralysed arre...    35   0.038
D45896-1|BAA82524.1|  161|Caenorhabditis elegans troponin C prot...    35   0.038
D45895-1|BAA82523.1|  161|Caenorhabditis elegans troponin C prot...    35   0.038
AC006676-5|AAK71383.2|  172|Caenorhabditis elegans Hypothetical ...    34   0.067
AJ132193-1|CAA10601.1|  149|Caenorhabditis elegans calmodulin pr...    33   0.12 
AF016429-2|AAB65364.1|  149|Caenorhabditis elegans Calmodulin pr...    33   0.12 
Z74036-5|CAA98489.3|  171|Caenorhabditis elegans Hypothetical pr...    33   0.15 
U64601-9|AAB04578.1|  314|Caenorhabditis elegans Hypothetical pr...    33   0.15 
AY190131-1|AAO33925.1|  171|Caenorhabditis elegans CNB-1 protein.      33   0.15 
AF228528-1|AAF34189.1|  314|Caenorhabditis elegans calumenin-lik...    33   0.15 
Z77655-5|CAB01132.2|  458|Caenorhabditis elegans Hypothetical pr...    32   0.36 
U50308-3|AAW88404.1| 1392|Caenorhabditis elegans Gut granule los...    32   0.36 
AL110490-6|CAB54442.2|  687|Caenorhabditis elegans Hypothetical ...    30   1.1  
U29488-8|AAA68777.1|  320|Caenorhabditis elegans Hypothetical pr...    29   3.3  
U64600-3|AAK39204.1|  656|Caenorhabditis elegans Temporarily ass...    28   4.4  
AF078783-5|AAC26922.1|  236|Caenorhabditis elegans Hypothetical ...    28   5.8  
AL032657-5|CAD27615.1| 1045|Caenorhabditis elegans Hypothetical ...    27   7.7  
AL032657-4|CAD27614.1| 1070|Caenorhabditis elegans Hypothetical ...    27   7.7  
AL032657-3|CAA21739.1| 1111|Caenorhabditis elegans Hypothetical ...    27   7.7  
AF332568-1|AAG60061.1| 1111|Caenorhabditis elegans CED-1 protein.      27   7.7  

>Z77653-1|CAB01124.1|  218|Caenorhabditis elegans Hypothetical
           protein C13C12.1 protein.
          Length = 218

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 17/54 (31%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+ ++  +EF Y +   G++ ++ E +E+  + D D  G I  +EF+
Sbjct: 159 FRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEIDYEEFV 212


>X04259-1|CAA27814.1|  161|Caenorhabditis elegans cal-1 protein.
          Length = 161

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 17/54 (31%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+ ++  +EF Y +   G++ ++ E +E+  + D D  G I  +EF+
Sbjct: 102 FRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEIDYEEFV 155


>U28740-5|AAA68320.1|  229|Caenorhabditis elegans Hypothetical
           protein B0563.7 protein.
          Length = 229

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 18/55 (32%), Positives = 28/55 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           ++F   D DGS  +  EE    +   GL  NK+E + +  + D D +G I  +EF
Sbjct: 55  QLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEVDADGNGEIDFEEF 109



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +3

Query: 369 IKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           +K T  EL   E  +LF+ FDTD SG+I  +E
Sbjct: 43  MKYTRKELK--EYRQLFNMFDTDGSGAIGNEE 72


>Z82282-1|CAB05271.1|  182|Caenorhabditis elegans Hypothetical
           protein T07G12.1 protein.
          Length = 182

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 18/66 (27%), Positives = 34/66 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DG+  +  +EF + +   G   ++ E +E+  + D D    I LDEF+  + P 
Sbjct: 101 FKVFDKDGNGYITAQEFKHFMTTMGERFSEEEVDEIIREVDKDGDEQIDLDEFVNMVAPI 160

Query: 489 MSESRR 506
           +S+  +
Sbjct: 161 VSDGTK 166



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DG+  +N +E    ++  GL   + E   + +++D D +G I   EF   ++  
Sbjct: 29  FKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEM 88

Query: 489 MSESRRKL 512
             E+ ++L
Sbjct: 89  NKETDQEL 96


>Z70034-1|CAA93852.2|  171|Caenorhabditis elegans Hypothetical
           protein C18E9.1 protein.
          Length = 171

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           FR  D DG+  +  +EF Y +   G + +  E +E+ ++ D D  G I  +EF
Sbjct: 113 FRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDIDGDGQIDYEEF 165


>AJ512489-1|CAD54672.1|  171|Caenorhabditis elegans calmodulin-like
           protein protein.
          Length = 171

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           FR  D DG+  +  +EF Y +   G + +  E +E+ ++ D D  G I  +EF
Sbjct: 113 FRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDIDGDGQIDYEEF 165


>L14433-5|AAA27976.2|  202|Caenorhabditis elegans Hypothetical
           protein C50C3.5 protein.
          Length = 202

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           +IF+ MDDDGS  ++  E    + E G++++    + +    D    G I  +EFL  +
Sbjct: 54  KIFQLMDDDGSGTISSSEVAKMLNELGIDVSPKVVQAVMRSSDVSGDGQIDFEEFLAAV 112


>U40427-2|AAA81468.2|  159|Caenorhabditis elegans Hypothetical
           protein F43C9.2 protein.
          Length = 159

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L L   F  +D D    L++ E    ++   +E  + E + +F + DTD +G IS +EF+
Sbjct: 22  LQLSETFDLLDVDKDGRLSRNEIAALLRTINVEPTRVELDFIFGEMDTDKTGKISKEEFV 81

Query: 471 IKIRPP 488
             ++ P
Sbjct: 82  NYMKSP 87



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/54 (24%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR+ D DG   + ++E    ++ T    +++   ++F   D +  G I+  EF+
Sbjct: 101 FRKFDSDGDGAITEDEMAEILRRTADLGDRAAISDMFKATDLNGDGKITFFEFV 154



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDI 574
           +E  F+K D  GDGAIT D++
Sbjct: 97  LEVQFRKFDSDGDGAITEDEM 117


>U70851-8|AAB09131.1|  164|Caenorhabditis elegans Calmodulin related
           genes protein 3 protein.
          Length = 164

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F+  D DG+ ++   EF   +   G+  ++ E EE+ ++ D D +G I  +EF+
Sbjct: 107 FKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDCDGNGEIDYEEFV 160


>U40423-5|AAA81454.2|  156|Caenorhabditis elegans Unidentified
           vitellogenin-linkedtranscript protein 2 protein.
          Length = 156

 Score = 36.7 bits (81), Expect = 0.013
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           IFR  D +G   + +EE    +++ G    + E + +F   D D  G+I   EFL+
Sbjct: 26  IFREFDLNGDGYIQREELRAVMQKMGQSPTEDELDAMFQAADKDCDGNIDFQEFLV 81


>Z48585-7|CAA88482.1|  160|Caenorhabditis elegans Hypothetical
           protein ZK673.7 protein.
          Length = 160

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 15/58 (25%), Positives = 31/58 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +N  +    ++     +++ E +E+ ++ D D SG++  DEF+
Sbjct: 97  LREAFRLYDKEGNGYINVSDLRDILRALDDNVSEEELDEMIAEIDADGSGTVDFDEFM 154



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 13/55 (23%), Positives = 25/55 (45%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + F   D +G   +   +    ++  G    + + ++L  +FD D SG I  +EF
Sbjct: 22  KYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKEFDADGSGEIEFEEF 76


>AF024493-4|AAB70321.2|  249|Caenorhabditis elegans Hypothetical
           protein F23F1.2 protein.
          Length = 249

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F   D+D +  L++EE    + E  L   +    +LF +FD D SG + L E++
Sbjct: 109 KVFEDFDEDFNMALSREELERVLAERFLVKPRENFPKLFFKFDVDKSGGLDLTEYM 164


>AB079299-1|BAB84566.1|  160|Caenorhabditis elegans troponin C
           protein.
          Length = 160

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 15/58 (25%), Positives = 31/58 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +N  +    ++     +++ E +E+ ++ D D SG++  DEF+
Sbjct: 97  LREAFRLYDKEGNGYINVSDLRDILRALDDNVSEEELDEMIAEIDADGSGTVDFDEFM 154



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 13/55 (23%), Positives = 25/55 (45%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + F   D +G   +   +    ++  G    + + ++L  +FD D SG I  +EF
Sbjct: 22  KYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKEFDADGSGEIEFEEF 76


>Z81053-2|CAB02878.2|  202|Caenorhabditis elegans Hypothetical
           protein E02A10.3 protein.
          Length = 202

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           ++F   D D S  +  +E    IK  GLE  + E +++  + D   +  I  DEF + +R
Sbjct: 60  QVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEFCVVMR 119



 Score = 35.9 bits (79), Expect = 0.022
 Identities = 17/64 (26%), Positives = 37/64 (57%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +F R ++ G   ++K++F + ++E G   +    +E+F++ D D +G I  DEF   ++ 
Sbjct: 138 VFDRSENGG---ISKKDFRFILRELGDITDNQIIDEIFNEADVDGNGVIDYDEFTYMVKN 194

Query: 486 PMSE 497
            M++
Sbjct: 195 YMTD 198



 Score = 28.7 bits (61), Expect = 3.3
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           L  +  L G  E  L+    E  ++F+ FD D SG+I++DE    I+
Sbjct: 41  LLSQHLLEGYSEEELQ----EYRQVFNMFDADRSGAIAIDELEAAIK 83


>Z80216-5|CAB02282.1|  190|Caenorhabditis elegans Hypothetical
           protein F10G8.5 protein.
          Length = 190

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           +FR  D D S  ++ +EFL  I  T     + + E  F  +D D +G+I   E +IKI
Sbjct: 70  VFRTFDTDNSGFIDFKEFLLAINVTSSGTPEQKLEWAFRMYDIDGNGTIDEKE-MIKI 126



 Score = 31.1 bits (67), Expect = 0.62
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSEA--EELFSQFDTDSSGSISLDEFLIKI 479
           L KE+F+   K+       +E   E +F  FDTD+SG I   EFL+ I
Sbjct: 45  LTKEQFIKVYKDF-FPSGSAEGFCEHVFRTFDTDNSGFIDFKEFLLAI 91


>L33681-1|AAA85632.1|  190|Caenorhabditis elegans neuronal calcium
           binding protein protein.
          Length = 190

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           +FR  D D S  ++ +EFL  I  T     + + E  F  +D D +G+I   E +IKI
Sbjct: 70  VFRTFDTDNSGFIDFKEFLLAINVTSSGTPEQKLEWAFRMYDIDGNGTIDEKE-MIKI 126



 Score = 31.1 bits (67), Expect = 0.62
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSEA--EELFSQFDTDSSGSISLDEFLIKI 479
           L KE+F+   K+       +E   E +F  FDTD+SG I   EFL+ I
Sbjct: 45  LTKEQFIKVYKDF-FPSGSAEGFCEHVFRTFDTDNSGFIDFKEFLLAI 91


>U88165-10|AAK21395.1|  161|Caenorhabditis elegans Paralysed arrest
           at two-fold protein10 protein.
          Length = 161

 Score = 35.1 bits (77), Expect = 0.038
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L   FR  D +G+  +++      +KE   +L   + EE   + D D SG I  +EF
Sbjct: 96  LREAFRLFDKEGNGYISRPTLKALLKEIADDLTDQQLEEAVDEIDEDGSGKIEFEEF 152



 Score = 30.7 bits (66), Expect = 0.82
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEF---LYGIKET-GLELNKSEAEELFSQFDTDSSGSIS 455
           L ++ R+ D DGS  L  +EF   +Y +  T   E  + E  E F  FD + +G IS
Sbjct: 56  LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLEKELREAFRLFDKEGNGYIS 112


>D45896-1|BAA82524.1|  161|Caenorhabditis elegans troponin C
           protein.
          Length = 161

 Score = 35.1 bits (77), Expect = 0.038
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L   FR  D +G+  +++      +KE   +L   + EE   + D D SG I  +EF
Sbjct: 96  LREAFRLFDKEGNGYISRPTLKALLKEIADDLTDQQLEEAVDEIDEDGSGKIEFEEF 152



 Score = 30.7 bits (66), Expect = 0.82
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEF---LYGIKET-GLELNKSEAEELFSQFDTDSSGSIS 455
           L ++ R+ D DGS  L  +EF   +Y +  T   E  + E  E F  FD + +G IS
Sbjct: 56  LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLEKELREAFRLFDKEGNGYIS 112


>D45895-1|BAA82523.1|  161|Caenorhabditis elegans troponin C
           protein.
          Length = 161

 Score = 35.1 bits (77), Expect = 0.038
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L   FR  D +G+  +++      +KE   +L   + EE   + D D SG I  +EF
Sbjct: 96  LREAFRLFDKEGNGYISRPTLKALLKEIADDLTDQQLEEAVDEIDEDGSGKIEFEEF 152



 Score = 30.7 bits (66), Expect = 0.82
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEF---LYGIKET-GLELNKSEAEELFSQFDTDSSGSIS 455
           L ++ R+ D DGS  L  +EF   +Y +  T   E  + E  E F  FD + +G IS
Sbjct: 56  LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLEKELREAFRLFDKEGNGYIS 112


>AC006676-5|AAK71383.2|  172|Caenorhabditis elegans Hypothetical
           protein M04F3.4 protein.
          Length = 172

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DGS  ++K E    + + G  L+      L  +FD   S  I+ D+F+
Sbjct: 79  FRGFDTDGSGNIDKSELTNALTQFGYRLSPQFYNILMHKFDRSHSNRINFDDFI 132


>AJ132193-1|CAA10601.1|  149|Caenorhabditis elegans calmodulin
           protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.12
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>AF016429-2|AAB65364.1|  149|Caenorhabditis elegans Calmodulin
           protein 1 protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.12
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>Z74036-5|CAA98489.3|  171|Caenorhabditis elegans Hypothetical
           protein F55C10.1 protein.
          Length = 171

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  +  L R F+++D DGS  L+ EEF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFM-SLPE--LQQNPL-VQRVIDIFDEDG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFREFI 76



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNK-SEAEELFSQFDTDSSGSISLDE 464
           R+    D+DG+  ++  EF+ GI +  ++ +K ++ +  F  +D D  G IS  E
Sbjct: 57  RVIDIFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGE 111


>U64601-9|AAB04578.1|  314|Caenorhabditis elegans Hypothetical
           protein M03F4.7a protein.
          Length = 314

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           D DG   LN+EE    I   G +  ++EA  L    D +  G ++LDE +
Sbjct: 239 DKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIV 288


>AY190131-1|AAO33925.1|  171|Caenorhabditis elegans CNB-1 protein.
          Length = 171

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  +  L R F+++D DGS  L+ EEF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFM-SLPE--LQQNPL-VQRVIDIFDEDG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFREFI 76



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNK-SEAEELFSQFDTDSSGSISLDE 464
           R+    D+DG+  ++  EF+ GI +  ++ +K ++ +  F  +D D  G IS  E
Sbjct: 57  RVIDIFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGE 111


>AF228528-1|AAF34189.1|  314|Caenorhabditis elegans calumenin-like
           protein protein.
          Length = 314

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           D DG   LN+EE    I   G +  ++EA  L    D +  G ++LDE +
Sbjct: 239 DKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIV 288


>Z77655-5|CAB01132.2|  458|Caenorhabditis elegans Hypothetical
           protein C56A3.6 protein.
          Length = 458

 Score = 31.9 bits (69), Expect = 0.36
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           FR MD  G  +++  E+++ +  T L  +K+     F  FD D +G+I  DEF++
Sbjct: 143 FRTMDQSG--IISYSEYIFLL--TLLTKSKAAFRIAFLMFDEDDNGNIDRDEFML 193


>U50308-3|AAW88404.1| 1392|Caenorhabditis elegans Gut granule loss
            protein 4 protein.
          Length = 1392

 Score = 31.9 bits (69), Expect = 0.36
 Identities = 14/51 (27%), Positives = 33/51 (64%)
 Frame = +3

Query: 312  RRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
            R +++DG++ ++KEE +  +K + + + ++ ++ L+S  +   +GSI  DE
Sbjct: 1155 RNLNEDGNEGVDKEEIVDRLKASDVNVVQAVSKHLYSPIEGKCNGSIIEDE 1205


>AL110490-6|CAB54442.2|  687|Caenorhabditis elegans Hypothetical
           protein Y48B6A.6a protein.
          Length = 687

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 16/59 (27%), Positives = 27/59 (45%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           IF++ D+D    ++  E    +++ G        +EL  + D D  G IS  EF +  R
Sbjct: 549 IFKKYDEDQDSYIDFNELKRMMEKLGEAQTHIALKELIKKVDEDQDGKISQREFFLIFR 607


>U29488-8|AAA68777.1|  320|Caenorhabditis elegans Hypothetical
           protein C56C10.9 protein.
          Length = 320

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIK---ETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F++ D +    L   E    I+   E  LE +K+++E  F   DT+  GSI  +EF
Sbjct: 70  MFKKTDVNDDGFLTAGELKQQIRKNMEEHLEKSKNDSEIFFDIVDTNKDGSIVWEEF 126


>U64600-3|AAK39204.1|  656|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 312 protein.
          Length = 656

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKET 380
           IF  +D DGS  + K EFL G ++T
Sbjct: 41  IFTELDQDGSGKIEKLEFLRGFQDT 65


>AF078783-5|AAC26922.1|  236|Caenorhabditis elegans Hypothetical
           protein H10E21.4 protein.
          Length = 236

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/54 (24%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F  +D +    L+++E +  +++ G    + + +E F +FD D +G + + EF+
Sbjct: 23  FDLVDANNDGKLSEKELITFMRKRG----RPDGQEYFQRFDLDRNGHLDISEFV 72


>AL032657-5|CAD27615.1| 1045|Caenorhabditis elegans Hypothetical
           protein Y47H9C.4c protein.
          Length = 1045

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +3

Query: 147 LSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLC 266
           L C   T  C  +PG   D  E +C   SY  + E + +C
Sbjct: 392 LMCAPNTGFCRCKPGFYGDNCELACSKDSYGPNCEKQAMC 431


>AL032657-4|CAD27614.1| 1070|Caenorhabditis elegans Hypothetical
           protein Y47H9C.4b protein.
          Length = 1070

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +3

Query: 147 LSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLC 266
           L C   T  C  +PG   D  E +C   SY  + E + +C
Sbjct: 392 LMCAPNTGFCRCKPGFYGDNCELACSKDSYGPNCEKQAMC 431


>AL032657-3|CAA21739.1| 1111|Caenorhabditis elegans Hypothetical
           protein Y47H9C.4a protein.
          Length = 1111

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +3

Query: 147 LSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLC 266
           L C   T  C  +PG   D  E +C   SY  + E + +C
Sbjct: 392 LMCAPNTGFCRCKPGFYGDNCELACSKDSYGPNCEKQAMC 431


>AF332568-1|AAG60061.1| 1111|Caenorhabditis elegans CED-1 protein.
          Length = 1111

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +3

Query: 147 LSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLC 266
           L C   T  C  +PG   D  E +C   SY  + E + +C
Sbjct: 392 LMCAPNTGFCRCKPGFYGDNCELACSKDSYGPNCEKQAMC 431


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,628,454
Number of Sequences: 27780
Number of extensions: 247156
Number of successful extensions: 831
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 740
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 829
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1268802960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).