SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U55366-1|AAA97980.2|  430|Caenorhabditis elegans Suppressor of c...    30   0.77 
AF419335-1|AAL15971.1|  430|Caenorhabditis elegans multisubstrat...    30   0.77 
Z80789-1|CAB02551.1|  708|Caenorhabditis elegans Hypothetical pr...    28   3.1  
U88180-1|AAB42294.1|  203|Caenorhabditis elegans Hypothetical pr...    28   3.1  
M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical pr...    28   3.1  
M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical pr...    28   3.1  
Z93785-1|CAB07858.1|  495|Caenorhabditis elegans Hypothetical pr...    27   5.5  
AF038614-10|AAB92063.1| 1655|Caenorhabditis elegans Hypothetical...    27   5.5  
U61954-8|AAM98018.1| 1005|Caenorhabditis elegans Hypothetical pr...    27   7.2  
U50301-2|AAM29675.1|  362|Caenorhabditis elegans Hypothetical pr...    27   7.2  

>U55366-1|AAA97980.2|  430|Caenorhabditis elegans Suppressor of clr
           protein 1 protein.
          Length = 430

 Score = 30.3 bits (65), Expect = 0.77
 Identities = 15/36 (41%), Positives = 20/36 (55%)
 Frame = +2

Query: 245 TAMAFEXTLSPFPSDAPLTSMDVERALSFAPRRGTA 352
           + +A   T SP PSD    S+DV+R L+F   R  A
Sbjct: 391 STLAATSTRSPTPSDIEYISVDVDRTLAFKQMRRAA 426


>AF419335-1|AAL15971.1|  430|Caenorhabditis elegans multisubstrate
           adaptor proteinSOC-1 protein.
          Length = 430

 Score = 30.3 bits (65), Expect = 0.77
 Identities = 15/36 (41%), Positives = 20/36 (55%)
 Frame = +2

Query: 245 TAMAFEXTLSPFPSDAPLTSMDVERALSFAPRRGTA 352
           + +A   T SP PSD    S+DV+R L+F   R  A
Sbjct: 391 STLAATSTRSPTPSDIEYISVDVDRTLAFKQMRRAA 426


>Z80789-1|CAB02551.1|  708|Caenorhabditis elegans Hypothetical
           protein F48C11.2 protein.
          Length = 708

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 20/86 (23%), Positives = 39/86 (45%)
 Frame = -3

Query: 327 LNARSTSILVRGASLGNGDSVXSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCR 148
           +++ +++I +  +S  +  S  + A + L  + ++T   T A NG   S  G+  +TTC+
Sbjct: 175 VSSTTSNISLTSSSTQSYSSSTAGATSSLFTI-KVTQSTTAAGNGQGGSGSGSA-TTTCK 232

Query: 147 TARRAYSKARMACDTGGKASWLLKAW 70
            +    S    A     K+  L   W
Sbjct: 233 CSAGDVSATTAASACSEKSGCLKNQW 258


>U88180-1|AAB42294.1|  203|Caenorhabditis elegans Hypothetical
           protein T27A3.4 protein.
          Length = 203

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = -3

Query: 213 LTTASNGSDSSSRGTEYSTT--CRTARRAYSKARMACDTGGKAS 88
           ++  S G  SSSRG+ Y  T   R+++R+ S++R    +G ++S
Sbjct: 104 VSRGSKGRRSSSRGSVYGRTGRSRSSKRSRSRSRPRTRSGSRSS 147


>M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical protein
            ZK370.4b protein.
          Length = 1353

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = +1

Query: 322  VELRSASWHRGLQELWR 372
            VE R+ASW  G+  LWR
Sbjct: 993  VETRAASWFNGMSSLWR 1009


>M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical protein
            ZK370.4a protein.
          Length = 1342

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = +1

Query: 322  VELRSASWHRGLQELWR 372
            VE R+ASW  G+  LWR
Sbjct: 982  VETRAASWFNGMSSLWR 998


>Z93785-1|CAB07858.1|  495|Caenorhabditis elegans Hypothetical
           protein W09D10.1 protein.
          Length = 495

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = -3

Query: 438 ASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSVXS 259
           + Y  KR +     +P  D+ Q P+ L  A  + G  +     +I  RG+S  NG S  S
Sbjct: 120 SKYEQKRYILRDFVYPRVDASQLPKSLSQAQKKVGTPV----VNIASRGSSSSNGHSTAS 175

Query: 258 NAIA 247
            A A
Sbjct: 176 AAAA 179


>AF038614-10|AAB92063.1| 1655|Caenorhabditis elegans Hypothetical
            protein F15E6.1 protein.
          Length = 1655

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = -1

Query: 443  EQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRSGTET 270
            E+R  +L+GQSP F  +R       +   R R  +A++   +A+     E R+   +T
Sbjct: 1383 EERSGLLAGQSPDFSEVRAQIEEENRMKERSRKREAKK---KAVEKEKKEHRKEPKKT 1437


>U61954-8|AAM98018.1| 1005|Caenorhabditis elegans Hypothetical protein
            F41H10.3b protein.
          Length = 1005

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%)
 Frame = -1

Query: 461  KRKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPY-SSEERR 285
            +R  P  +   +L+  + T P ++    NS QS  RPR       ++ A  P  ++ +RR
Sbjct: 931  RRWDPLPKSSGVLAHSNSTIPYVQRVPNNSTQSDFRPRSFSQNSVASPAPAPVPNAIKRR 990

Query: 284  SG 279
             G
Sbjct: 991  EG 992


>U50301-2|AAM29675.1|  362|Caenorhabditis elegans Hypothetical
           protein F20D6.5 protein.
          Length = 362

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +1

Query: 283 ERRSSDEYGRRARVELRSASWHRGLQELWRLFAVVV 390
           E+     Y  RA V+ +S +W    Q+L RLF   +
Sbjct: 244 EKHCDGSYKFRAIVDFQSVNWGNAAQDLSRLFVTAM 279


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,101,001
Number of Sequences: 27780
Number of extensions: 169159
Number of successful extensions: 569
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 547
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 569
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 903458030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).