BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0255.Seq (505 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58757-2|AAC47915.2| 402|Caenorhabditis elegans Hypothetical pr... 31 0.63 AL110485-20|CAB60368.2| 600|Caenorhabditis elegans Hypothetical... 29 2.5 U39676-1|AAB37030.1| 186|Caenorhabditis elegans Hypothetical pr... 27 7.7 >U58757-2|AAC47915.2| 402|Caenorhabditis elegans Hypothetical protein C01B10.3 protein. Length = 402 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 7 SSAVMCQCLAVTERFYTIFRGAESFYSTKLESFSSLELYK 126 ++ V+C C+ Y F + +F+ TKL +L L+K Sbjct: 59 AARVICGCITDNPEIYRAFDSSMAFFDTKLTGLGNLYLFK 98 >AL110485-20|CAB60368.2| 600|Caenorhabditis elegans Hypothetical protein Y46G5A.25 protein. Length = 600 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 154 CGVVLCT-RGSFTFLVFDSQNLALAFYVTAVRACVFIS 264 CGV+L T G + F +FD ++A C+ IS Sbjct: 409 CGVILTTDAGIYWFALFDEYGSGFGALISATSMCIIIS 446 >U39676-1|AAB37030.1| 186|Caenorhabditis elegans Hypothetical protein C23F12.4 protein. Length = 186 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -3 Query: 209 CESNTRKVNEPRVQSTTPHVALRESD*GLYNSNDENDSSFVL 84 CE + +PR +S T V LR+ L ++D+N+ +FVL Sbjct: 33 CEQHG-STEDPRKESITARVFLRKRMKELPETDDKNNKAFVL 73 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,905,293 Number of Sequences: 27780 Number of extensions: 176360 Number of successful extensions: 466 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -