BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0237.Seq (907 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40030-2|AAR12978.2| 292|Caenorhabditis elegans Hypothetical pr... 28 8.0 >U40030-2|AAR12978.2| 292|Caenorhabditis elegans Hypothetical protein T13C2.7 protein. Length = 292 Score = 28.3 bits (60), Expect = 8.0 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 2/81 (2%) Frame = -1 Query: 373 DKTEKLTVFFPDPVLRVGKIGIPHQRNAVTPVIRFYKGMPQVVLSSHSSRIAGSS--ERC 200 ++ KL + P P R + + Q N + P+ + Q+VLS SS + S Sbjct: 213 EERPKLCLLLPPPNRR--RKSVTTQNNTI-PIHKSVS-CQQLVLSRKSSMSSAHSVSPSL 268 Query: 199 ASRIMVYFPDSNSSQPHDHSP 137 + I+ FPDS ++ P+D P Sbjct: 269 SEEIVFNFPDSGTATPNDSPP 289 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,118,043 Number of Sequences: 27780 Number of extensions: 545212 Number of successful extensions: 1277 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1277 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2307803960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -