BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0214.Seq (886 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89792-1|AAB94380.1| 339|Caenorhabditis elegans seven-in-absent... 33 0.36 AC024759-5|AAK68432.1| 419|Caenorhabditis elegans Hypothetical ... 33 0.36 U21308-5|AAB93318.1| 258|Caenorhabditis elegans Warthog (hedgeh... 30 2.5 U21317-6|AAA62527.1| 313|Caenorhabditis elegans Hypothetical pr... 29 3.3 AF038605-2|AAB92020.1| 698|Caenorhabditis elegans Hypothetical ... 29 4.4 Z95310-3|CAB08562.3| 1026|Caenorhabditis elegans Hypothetical pr... 28 7.7 Z92790-6|CAH60783.2| 1026|Caenorhabditis elegans Hypothetical pr... 28 7.7 >U89792-1|AAB94380.1| 339|Caenorhabditis elegans seven-in-absentia protein homologue-1 protein. Length = 339 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 149 DELPDLDNLLQCPVCYEIPTGHIFQCNEGHNVCGRLK 259 D ++ ++ +CPVC E QC+ GH VC + Sbjct: 79 DSSAEILSVFECPVCLEYMLPPYMQCSSGHLVCSNCR 115 >AC024759-5|AAK68432.1| 419|Caenorhabditis elegans Hypothetical protein Y37E11AR.2 protein. Length = 419 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 149 DELPDLDNLLQCPVCYEIPTGHIFQCNEGHNVCGRLK 259 D ++ ++ +CPVC E QC+ GH VC + Sbjct: 145 DSSAEILSVFECPVCLEYMLPPYMQCSSGHLVCSNCR 181 >U21308-5|AAB93318.1| 258|Caenorhabditis elegans Warthog (hedgehog-like family)protein 10 protein. Length = 258 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 406 SSTPARDSGSDNAEYLGEDENNDNQNSVVAPN 501 ++TP + ++ AE L ED+ NDN+ +V N Sbjct: 182 TTTPTVEEEAEEAEQLEEDQPNDNEAEIVESN 213 >U21317-6|AAA62527.1| 313|Caenorhabditis elegans Hypothetical protein B0495.8a protein. Length = 313 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/55 (40%), Positives = 27/55 (49%) Frame = +1 Query: 319 MEELIANVRKLRAFKLGGKVTRGLLASDSSSTPARDSGSDNAEYLGEDENNDNQN 483 M+E I RK R KLG + RG +S RD G D EY G D + D +N Sbjct: 229 MKETIDERRKEREEKLGSQ--RGYQRRESYGR--RDRGGDRGEYRG-DRDRDRRN 278 >AF038605-2|AAB92020.1| 698|Caenorhabditis elegans Hypothetical protein C02B10.5 protein. Length = 698 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 1/88 (1%) Frame = +1 Query: 394 ASDSSSTPARDSGSDNAEYLGEDENNDNQNSVVAPNPCKDFFVASGCKNGNSIRLPGS-S 570 ++D TP +E + E+EN+D ++ P+ +D S +G S P S Sbjct: 20 SADEDVTPTASPSLVKSEVVKEEENDDADRTLTMPSTSQDIQPESSPAHGRS--APSSQE 77 Query: 571 FT*PPSLTFILPELLEGRAEXVEYLQSM 654 T PP++ + L E + M Sbjct: 78 ITSPPTVRRVATPLEAAEQEYYYFTTDM 105 >Z95310-3|CAB08562.3| 1026|Caenorhabditis elegans Hypothetical protein H40L08.3 protein. Length = 1026 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +3 Query: 177 FSVQYVMKSLQVIFSNAMKVIMYVAD*SSAFCLPGMQGTIFWNQE 311 F + +M + Q++FS K +M++ + FC+ I W+ + Sbjct: 507 FEKELIMDTKQMLFSRDNKFLMFLTKSDNVFCVDLSSKKILWSTD 551 >Z92790-6|CAH60783.2| 1026|Caenorhabditis elegans Hypothetical protein H40L08.3 protein. Length = 1026 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +3 Query: 177 FSVQYVMKSLQVIFSNAMKVIMYVAD*SSAFCLPGMQGTIFWNQE 311 F + +M + Q++FS K +M++ + FC+ I W+ + Sbjct: 507 FEKELIMDTKQMLFSRDNKFLMFLTKSDNVFCVDLSSKKILWSTD 551 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,235,542 Number of Sequences: 27780 Number of extensions: 393046 Number of successful extensions: 972 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2234373834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -