BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0149.Seq (548 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL161712-21|CAC70129.2| 729|Caenorhabditis elegans Hypothetical... 29 2.2 >AL161712-21|CAC70129.2| 729|Caenorhabditis elegans Hypothetical protein Y66D12A.5 protein. Length = 729 Score = 29.1 bits (62), Expect = 2.2 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = -1 Query: 512 TPRGPTTSYFANYNFAGLIFITRCYSFTVEVNR*PFIKYVFYCKNWYIGTWQDTNAPSSS 333 T R YF +N++G + T C V+ P Y NWY + DTN +S Sbjct: 150 TARNLMLQYFKRFNYSGPLPSTGCIHLVVDRLVLPPDLIRDYYVNWYKFSDDDTNDQNSQ 209 Query: 332 Y 330 + Sbjct: 210 F 210 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,074,549 Number of Sequences: 27780 Number of extensions: 270820 Number of successful extensions: 733 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -