BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0132.Seq (558 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35641-1|CAA84706.2| 863|Caenorhabditis elegans Hypothetical pr... 27 9.1 L37867-1|AAA63155.1| 319|Caenorhabditis elegans homeodomain pro... 27 9.1 >Z35641-1|CAA84706.2| 863|Caenorhabditis elegans Hypothetical protein C38H2.1 protein. Length = 863 Score = 27.1 bits (57), Expect = 9.1 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 151 GSQAFIATLLFDPS-MSALPIIAKQNSPSVGLFTHQRERE 267 G + + TL PS MS L IIAK N P+ + RE E Sbjct: 116 GLRRRLLTLFNSPSSMSLLQIIAKSNGPAQQVLDQTREIE 155 >L37867-1|AAA63155.1| 319|Caenorhabditis elegans homeodomain protein protein. Length = 319 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 474 LPDSARLASALEAFRHNPADGSFXXXXXXXXX*TKCPKLRFLS 346 LPD + ++S+L HNP ++ TK PKL LS Sbjct: 37 LPDDS-ISSSLAPLTHNPYAFNYSIPLPPTDITTKLPKLELLS 78 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,411,634 Number of Sequences: 27780 Number of extensions: 242928 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -