SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z46266-5|CAA86412.1|  375|Caenorhabditis elegans Hypothetical pr...    35   0.036
U50308-3|AAW88404.1| 1392|Caenorhabditis elegans Gut granule los...    27   5.5  
U10402-3|AAK95874.1|  734|Caenorhabditis elegans Hypothetical pr...    27   7.3  
Z81033-2|CAB02725.1|  263|Caenorhabditis elegans Hypothetical pr...    27   9.7  
AJ011777-1|CAA09770.1|  263|Caenorhabditis elegans FOG-3 protein...    27   9.7  
AF078787-10|AAC26956.1|  352|Caenorhabditis elegans Hypothetical...    27   9.7  
AF024500-6|AAB70361.1|  357|Caenorhabditis elegans Hypothetical ...    27   9.7  

>Z46266-5|CAA86412.1|  375|Caenorhabditis elegans Hypothetical
           protein C07B5.5 protein.
          Length = 375

 Score = 34.7 bits (76), Expect = 0.036
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = -1

Query: 382 PDETVLKFYIDASYPEGNFGRTQLLDGSISLSPLYPVPTIDLQSESLRSSIRVSPDCDLT 203
           P ++V++    A Y   NF +++  +  +  + + P    DL  E+ R    +  DC LT
Sbjct: 239 PFQSVIELETMAGYSFTNFAKSKEFNADLYDTLVAPTLKTDLVVETWRRGSEIPLDCKLT 298

Query: 202 RHSSPSFGSQHLCSERAFIH*LETSRLG-SAKIT 104
            H++ +  S H+ S  AF +  + S++  SA +T
Sbjct: 299 YHANDAL-SIHVGSTTAFSYTKDHSKMAHSADMT 331


>U50308-3|AAW88404.1| 1392|Caenorhabditis elegans Gut granule loss
            protein 4 protein.
          Length = 1392

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = -1

Query: 313  LLDGSISLSPLYPVPTIDLQSESLRSSIRVSPDCDLTRHSSP-SFGSQHLCS 161
            +LDG  S S     PTI   S  + S IRV   C    H+ P + GS   CS
Sbjct: 1326 MLDGFTSASKPVSCPTIPSSSLEVSSKIRVYAQC---AHAEPAAVGSPPECS 1374


>U10402-3|AAK95874.1|  734|Caenorhabditis elegans Hypothetical
           protein C34E10.5 protein.
          Length = 734

 Score = 27.1 bits (57), Expect = 7.3
 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 4/51 (7%)
 Frame = -1

Query: 286 PLYPVPTIDLQSESLRSSI--RVSP--DCDLTRHSSPSFGSQHLCSERAFI 146
           P+  +P + L+++   S +  ++SP  DCD +  +  S   +HL  E ++I
Sbjct: 105 PVIDLPDVQLRNDLWESYVVGKISPWIDCDSSDPAFASLSEEHLLKELSYI 155


>Z81033-2|CAB02725.1|  263|Caenorhabditis elegans Hypothetical
           protein C03C11.2 protein.
          Length = 263

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = -2

Query: 300 RLVFRPYTQ--FRRSICSQNRYGPPSGFPLTAT*PGIVHHLSGPSICAQSAPSFT 142
           R V++P +   F     SQ R+G     P   T   ++ +LS   + + S+PSFT
Sbjct: 196 RFVYKPSSAQTFSGVEFSQTRFGSSKSRPDLQT-MDVIKYLSSQQVSSSSSPSFT 249


>AJ011777-1|CAA09770.1|  263|Caenorhabditis elegans FOG-3 protein
           protein.
          Length = 263

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = -2

Query: 300 RLVFRPYTQ--FRRSICSQNRYGPPSGFPLTAT*PGIVHHLSGPSICAQSAPSFT 142
           R V++P +   F     SQ R+G     P   T   ++ +LS   + + S+PSFT
Sbjct: 196 RFVYKPSSAQTFSGVEFSQTRFGSSKSRPDLQT-MDVIKYLSSQQVSSSSSPSFT 249


>AF078787-10|AAC26956.1|  352|Caenorhabditis elegans Hypothetical
           protein T17A3.10 protein.
          Length = 352

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 4/51 (7%)
 Frame = -1

Query: 322 RTQLLDGSISLSPLY----PVPTIDLQSESLRSSIRVSPDCDLTRHSSPSF 182
           R QLL+  I + P      P+ +  +   + +SSI +   C++T H  P +
Sbjct: 215 RRQLLETVIKVKPASTRPEPIKSSKMAIPNCKSSIEIEIQCNITGHPLPEY 265


>AF024500-6|AAB70361.1|  357|Caenorhabditis elegans Hypothetical
           protein K06H6.1 protein.
          Length = 357

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -1

Query: 292 LSPLYPVPTIDLQSESLRSSIRVSPDCDLTRHSSPSFGSQHLCSER 155
           + P YPVPT+ + +E   S I  S   +++    P+F  Q +  +R
Sbjct: 70  IRPTYPVPTVKMVAEPTCSEI-FSGWREVSEQPQPTFPPQEIPEDR 114


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,679,409
Number of Sequences: 27780
Number of extensions: 224083
Number of successful extensions: 472
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 461
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 472
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 914086948
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).