SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U29376-5|AAA68709.2|  936|Caenorhabditis elegans Protein kinase ...    63   9e-11
U29376-4|AAM51504.1|  682|Caenorhabditis elegans Protein kinase ...    63   9e-11
U29376-3|AAM51503.1|  680|Caenorhabditis elegans Protein kinase ...    63   9e-11
U82936-1|AAB40869.1|  682|Caenorhabditis elegans protein kinase ...    62   2e-10
U82935-1|AAB40868.1|  680|Caenorhabditis elegans protein kinase ...    62   2e-10
U00051-15|AAZ91344.1|  270|Caenorhabditis elegans Synaptotagmin ...    60   1e-09
U55856-5|AAA98023.1|  441|Caenorhabditis elegans Synaptotagmin p...    55   3e-08
U55856-4|AAK68354.1|  443|Caenorhabditis elegans Synaptotagmin p...    55   3e-08
L15302-1|AAA28145.1|  441|Caenorhabditis elegans synaptotagmin I...    55   3e-08
AC024869-3|AAK68605.2|  452|Caenorhabditis elegans Synaptotagmin...    53   1e-07
AJ303369-1|CAC33880.1|  153|Caenorhabditis elegans synaptotagmin...    52   3e-07
U88167-10|AAB42222.1|  804|Caenorhabditis elegans Hypothetical p...    45   3e-05
U88167-9|AAK68288.1|  890|Caenorhabditis elegans Hypothetical pr...    45   3e-05
U00032-4|AAL32216.1|  953|Caenorhabditis elegans Rabphilin prote...    44   5e-05
U00032-3|AAL32217.1| 1028|Caenorhabditis elegans Rabphilin prote...    44   5e-05
U00032-2|AAL32218.1|  962|Caenorhabditis elegans Rabphilin prote...    44   5e-05
U00032-1|AAM48523.1| 1106|Caenorhabditis elegans Rabphilin prote...    44   5e-05
AF399852-1|AAK84870.1|  953|Caenorhabditis elegans rabphilin pro...    44   5e-05
AF098985-4|AAC67422.2|  373|Caenorhabditis elegans Synaptotagmin...    44   5e-05
AJ303370-1|CAC33881.1|  155|Caenorhabditis elegans synaptotagmin...    44   8e-05
U80033-1|AAM15607.1|  381|Caenorhabditis elegans Synaptotagmin p...    42   3e-04
AF016680-1|AAB66163.2|  458|Caenorhabditis elegans Synaptotagmin...    41   6e-04
Z92779-4|CAE11294.1| 1816|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z92779-3|CAD90173.2| 2155|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z92779-2|CAD56561.2| 1475|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z92779-1|CAB07173.1| 1813|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z79694-11|CAE11299.1| 1816|Caenorhabditis elegans Hypothetical p...    40   0.001
Z79694-10|CAD90170.2| 2155|Caenorhabditis elegans Hypothetical p...    40   0.001
Z79694-9|CAB01966.1| 1813|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z73912-7|CAE11317.1| 1816|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z73912-6|CAD90190.2| 2155|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z73912-5|CAD56619.2| 1475|Caenorhabditis elegans Hypothetical pr...    40   0.001
Z73912-4|CAA98147.1| 1813|Caenorhabditis elegans Hypothetical pr...    40   0.001
M62830-1|AAA93094.1| 1815|Caenorhabditis elegans UNC-13 protein.       40   0.001
AF077533-1|AAZ91357.1| 1126|Caenorhabditis elegans Hypothetical ...    39   0.002
AF077533-2|AAP40529.1|  972|Caenorhabditis elegans Hypothetical ...    36   0.016
Z48809-1|CAA88745.1| 1299|Caenorhabditis elegans Hypothetical pr...    35   0.029
U13019-3|AAC24452.2|  713|Caenorhabditis elegans Hypothetical pr...    33   0.12 
U41016-5|AAP46274.1|  811|Caenorhabditis elegans Hypothetical pr...    30   1.1  
U41016-4|AAP46275.1|  809|Caenorhabditis elegans Hypothetical pr...    30   1.1  
U41016-3|AAM51497.1|  901|Caenorhabditis elegans Hypothetical pr...    30   1.1  
U41016-2|AAM51496.1|  899|Caenorhabditis elegans Hypothetical pr...    30   1.1  
Z81564-9|CAB04575.1|  724|Caenorhabditis elegans Hypothetical pr...    28   3.3  
Z73911-4|CAA98141.2|  625|Caenorhabditis elegans Hypothetical pr...    27   5.7  
Z46933-4|CAA87037.1|  452|Caenorhabditis elegans Hypothetical pr...    27   7.6  
AC024847-5|AAN73850.1|  792|Caenorhabditis elegans Ww domain pro...    27   7.6  
AC024847-4|AAN73849.1|  794|Caenorhabditis elegans Ww domain pro...    27   7.6  
AC006816-6|ABA00154.1|  506|Caenorhabditis elegans Hypothetical ...    27   7.6  
Z78019-2|CAB01451.1|  347|Caenorhabditis elegans Hypothetical pr...    27   10.0 
Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical pr...    27   10.0 

>U29376-5|AAA68709.2|  936|Caenorhabditis elegans Protein kinase c
           protein 2, isoformc protein.
          Length = 936

 Score = 63.3 bits (147), Expect = 9e-11
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L ++++EA +L+P DPNGLSDP+V   L+   S    +  T     TLNP W E F+  +
Sbjct: 315 LTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKL 374

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  L +EVWD+D
Sbjct: 375 LPGDKDRRLSIEVWDWD 391


>U29376-4|AAM51504.1|  682|Caenorhabditis elegans Protein kinase c
           protein 2, isoformb protein.
          Length = 682

 Score = 63.3 bits (147), Expect = 9e-11
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L ++++EA +L+P DPNGLSDP+V   L+   S    +  T     TLNP W E F+  +
Sbjct: 175 LTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKL 234

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  L +EVWD+D
Sbjct: 235 LPGDKDRRLSIEVWDWD 251


>U29376-3|AAM51503.1|  680|Caenorhabditis elegans Protein kinase c
           protein 2, isoforma protein.
          Length = 680

 Score = 63.3 bits (147), Expect = 9e-11
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L ++++EA +L+P DPNGLSDP+V   L+   S    +  T     TLNP W E F+  +
Sbjct: 175 LTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKL 234

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  L +EVWD+D
Sbjct: 235 LPGDKDRRLSIEVWDWD 251


>U82936-1|AAB40869.1|  682|Caenorhabditis elegans protein kinase C2
           B isoform protein.
          Length = 682

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L ++++EA +L+P DPNGLSDP+V   L+   S    +  T     TLNP W E F+  +
Sbjct: 175 LTIKILEAKNLIPMDPNGLSDPYVKWKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKL 234

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  L +EVWD+D
Sbjct: 235 LPGDKDRRLSIEVWDWD 251


>U82935-1|AAB40868.1|  680|Caenorhabditis elegans protein kinase C2
           A isoform protein.
          Length = 680

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L ++++EA +L+P DPNGLSDP+V   L+   S    +  T     TLNP W E F+  +
Sbjct: 175 LTIKILEAKNLIPMDPNGLSDPYVKWKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKL 234

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  L +EVWD+D
Sbjct: 235 LPGDKDRRLSIEVWDWD 251


>U00051-15|AAZ91344.1|  270|Caenorhabditis elegans Synaptotagmin
           protein 2 protein.
          Length = 270

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMS 435
           L+V +V A+DL   D NG+SDP+V +Y++     ++ T +   TLNP + E   FS+P +
Sbjct: 1   LSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFN 60

Query: 436 GTVNEDSLCLEVWDFD 483
             ++  +L L V+D+D
Sbjct: 61  -ELHSKTLMLVVYDYD 75



 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPMS 435
           + + ++EA +L   D  G SDP+V IYL        +  TS K  TLNP + E F   + 
Sbjct: 134 VTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIE 193

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + VWD+D
Sbjct: 194 PHMIEKVHLIVSVWDYD 210


>U55856-5|AAA98023.1|  441|Caenorhabditis elegans Synaptotagmin
           protein 1, isoform a protein.
          Length = 441

 Score = 54.8 bits (126), Expect = 3e-08
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A DL   D +G SDP+V +YL+     +  T V   TLNPV+ E F   ++  
Sbjct: 176 LTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFN 235

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L   ++DFD
Sbjct: 236 EITAKTLVFAIYDFD 250



 Score = 51.6 bits (118), Expect = 3e-07
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I LM       +  TS+K  TLNP + E FS  + 
Sbjct: 309 LTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVP 368

Query: 436 -GTVNEDSLCLEVWDFD 483
              + + SL + V D+D
Sbjct: 369 FEQIQKVSLMITVMDYD 385


>U55856-4|AAK68354.1|  443|Caenorhabditis elegans Synaptotagmin
           protein 1, isoform b protein.
          Length = 443

 Score = 54.8 bits (126), Expect = 3e-08
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A DL   D +G SDP+V +YL+     +  T V   TLNPV+ E F   ++  
Sbjct: 176 LTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFN 235

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L   ++DFD
Sbjct: 236 EITAKTLVFAIYDFD 250



 Score = 43.6 bits (98), Expect = 8e-05
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 6/80 (7%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY---NTSVKSGTLNPVWEEHF---S 423
           L V ++EA +L   D  GLSDP+V + +      R     T++K  TLNP + E F    
Sbjct: 309 LTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDK 368

Query: 424 LPMSGTVNEDSLCLEVWDFD 483
           LP+   + + SL + V D+D
Sbjct: 369 LPLH-KMKKVSLMITVMDYD 387


>L15302-1|AAA28145.1|  441|Caenorhabditis elegans synaptotagmin I
           protein.
          Length = 441

 Score = 54.8 bits (126), Expect = 3e-08
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A DL   D +G SDP+V +YL+     +  T V   TLNPV+ E F   ++  
Sbjct: 176 LTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFN 235

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L   ++DFD
Sbjct: 236 EITAKTLVFAIYDFD 250



 Score = 51.6 bits (118), Expect = 3e-07
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I LM       +  TS+K  TLNP + E FS  + 
Sbjct: 309 LTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVP 368

Query: 436 -GTVNEDSLCLEVWDFD 483
              + + SL + V D+D
Sbjct: 369 FEQIQKVSLMITVMDYD 385


>AC024869-3|AAK68605.2|  452|Caenorhabditis elegans Synaptotagmin
           protein 3 protein.
          Length = 452

 Score = 52.8 bits (121), Expect = 1e-07
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A +L   D  G SDP+V ++L+ +   +  T V+  +LNPV+ E F+  +   
Sbjct: 32  LTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFN 91

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L L V+DFD
Sbjct: 92  EIGGQTLVLNVFDFD 106



 Score = 48.4 bits (110), Expect = 3e-06
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPM- 432
           L+V V+E  +L   D  GLSDP+V IYLM  +    +  T++K  TLNP + E FS  + 
Sbjct: 160 LSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVT 219

Query: 433 SGTVNEDSLCLEVWDFD 483
           S  +    L + V D+D
Sbjct: 220 SEKMQRVHLHVTVSDYD 236


>AJ303369-1|CAC33880.1|  153|Caenorhabditis elegans synaptotagmin 1
           protein.
          Length = 153

 Score = 51.6 bits (118), Expect = 3e-07
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I LM       +  TS+K  TLNP + E FS  + 
Sbjct: 28  LTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVP 87

Query: 436 -GTVNEDSLCLEVWDFD 483
              + + SL + V D+D
Sbjct: 88  FEQIQKVSLMITVMDYD 104


>U88167-10|AAB42222.1|  804|Caenorhabditis elegans Hypothetical
           protein D2092.1a protein.
          Length = 804

 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L++ V +    DL  KD +G SDP+V      N  ++  T  K+  LNP W+E F +   
Sbjct: 57  LLMEVRLKNGEDLPVKDASGSSDPYVKFRYKDNIVYKSGTIFKN--LNPSWDEEFQM--- 111

Query: 436 GTVNEDSLC---LEVWDFD 483
             + +D  C   LEV+DFD
Sbjct: 112 --IVDDVTCPIRLEVFDFD 128



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           + N  V  A DLV KD  G SDPF  + L+ N+  + NT  K  TL+P W + ++     
Sbjct: 446 LFNCLVFGAEDLVAKDFGGKSDPFAVLELV-NTRVQTNTIYK--TLSPSWNKIYTF---- 498

Query: 439 TVNEDSLCLEV--WDFDP 486
            V +   CL+V  +D DP
Sbjct: 499 AVKDIHTCLQVTIYDEDP 516


>U88167-9|AAK68288.1|  890|Caenorhabditis elegans Hypothetical
           protein D2092.1b protein.
          Length = 890

 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L++ V +    DL  KD +G SDP+V      N  ++  T  K+  LNP W+E F +   
Sbjct: 143 LLMEVRLKNGEDLPVKDASGSSDPYVKFRYKDNIVYKSGTIFKN--LNPSWDEEFQM--- 197

Query: 436 GTVNEDSLC---LEVWDFD 483
             + +D  C   LEV+DFD
Sbjct: 198 --IVDDVTCPIRLEVFDFD 214



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           + N  V  A DLV KD  G SDPF  + L+ N+  + NT  K  TL+P W + ++     
Sbjct: 532 LFNCLVFGAEDLVAKDFGGKSDPFAVLELV-NTRVQTNTIYK--TLSPSWNKIYTF---- 584

Query: 439 TVNEDSLCLEV--WDFDP 486
            V +   CL+V  +D DP
Sbjct: 585 AVKDIHTCLQVTIYDEDP 602


>U00032-4|AAL32216.1|  953|Caenorhabditis elegans Rabphilin protein 1,
            isoform a protein.
          Length = 953

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
            L + +    +LV  D  G SDP+  + L  +++ +HR  TS K  TLNP W E   F +P
Sbjct: 831  LFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVP 890

Query: 430  MSGTVNEDSLCLEVWDFD 483
                + + +L + V+D D
Sbjct: 891  FK-DLPKKTLQIGVYDHD 907



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFS 423
           L + ++ A +L   D NG SDP+V  +L+  ++     + K+   TLNP W E  S
Sbjct: 691 LKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMS 746


>U00032-3|AAL32217.1| 1028|Caenorhabditis elegans Rabphilin protein 1,
            isoform b protein.
          Length = 1028

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
            L + +    +LV  D  G SDP+  + L  +++ +HR  TS K  TLNP W E   F +P
Sbjct: 906  LFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVP 965

Query: 430  MSGTVNEDSLCLEVWDFD 483
                + + +L + V+D D
Sbjct: 966  FK-DLPKKTLQIGVYDHD 982



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFS 423
           L + ++ A +L   D NG SDP+V  +L+  ++     + K+   TLNP W E  S
Sbjct: 766 LKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMS 821


>U00032-2|AAL32218.1|  962|Caenorhabditis elegans Rabphilin protein 1,
            isoform c protein.
          Length = 962

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
            L + +    +LV  D  G SDP+  + L  +++ +HR  TS K  TLNP W E   F +P
Sbjct: 840  LFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVP 899

Query: 430  MSGTVNEDSLCLEVWDFD 483
                + + +L + V+D D
Sbjct: 900  FK-DLPKKTLQIGVYDHD 916



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFS 423
           L + ++ A +L   D NG SDP+V  +L+  ++     + K+   TLNP W E  S
Sbjct: 700 LKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMS 755


>U00032-1|AAM48523.1| 1106|Caenorhabditis elegans Rabphilin protein 1,
            isoform d protein.
          Length = 1106

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
            L + +    +LV  D  G SDP+  + L  +++ +HR  TS K  TLNP W E   F +P
Sbjct: 984  LFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVP 1043

Query: 430  MSGTVNEDSLCLEVWDFD 483
                + + +L + V+D D
Sbjct: 1044 FK-DLPKKTLQIGVYDHD 1060



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFS 423
            L + ++ A +L   D NG SDP+V  +L+  ++     + K+   TLNP W E  S
Sbjct: 844  LKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMS 899


>AF399852-1|AAK84870.1|  953|Caenorhabditis elegans rabphilin protein.
          Length = 953

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
            L + +    +LV  D  G SDP+  + L  +++ +HR  TS K  TLNP W E   F +P
Sbjct: 831  LFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVP 890

Query: 430  MSGTVNEDSLCLEVWDFD 483
                + + +L + V+D D
Sbjct: 891  FK-DLPKKTLQIGVYDHD 907



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFS 423
           L + ++ A +L   D NG SDP+V  +L+  ++     + K+   TLNP W E  S
Sbjct: 691 LKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMS 746


>AF098985-4|AAC67422.2|  373|Caenorhabditis elegans Synaptotagmin
           protein 6 protein.
          Length = 373

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL--PMS 435
           L+V ++EA DL  KD  G SDP+V  +L+ +      + V    LNP + E  S      
Sbjct: 118 LHVHLMEAVDLPVKDFTGSSDPYVRAFLLQDPGQSERSKVHRRNLNPTFNETLSFRGHSM 177

Query: 436 GTVNEDSLCLEVWDFD 483
             +++ +L L+V D+D
Sbjct: 178 KKLHDMTLVLQVMDYD 193


>AJ303370-1|CAC33881.1|  155|Caenorhabditis elegans synaptotagmin 1
           protein.
          Length = 155

 Score = 43.6 bits (98), Expect = 8e-05
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 6/80 (7%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY---NTSVKSGTLNPVWEEHF---S 423
           L V ++EA +L   D  GLSDP+V + +      R     T++K  TLNP + E F    
Sbjct: 28  LTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDK 87

Query: 424 LPMSGTVNEDSLCLEVWDFD 483
           LP+   + + SL + V D+D
Sbjct: 88  LPLH-KMKKVSLMITVMDYD 106


>U80033-1|AAM15607.1|  381|Caenorhabditis elegans Synaptotagmin
           protein 4 protein.
          Length = 381

 Score = 41.5 bits (93), Expect = 3e-04
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY---NTSVKSGTLNPVWEEHF 420
           L V V++A  L  ++  G +DPFV +YL   S  R     T V+  TLNPV+ E F
Sbjct: 266 LTVVVLKARGLGGRNDAGTADPFVKLYLRKESGERIVKKRTHVRRSTLNPVYNESF 321



 Score = 38.7 bits (86), Expect = 0.002
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +1

Query: 292 LVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +V +D   L DP+V + L+    HR  T +   T +PV+EE F++
Sbjct: 142 VVSRDGQCLLDPYVKLQLLPEREHRVKTRIVRSTTSPVYEEQFAM 186


>AF016680-1|AAB66163.2|  458|Caenorhabditis elegans Synaptotagmin
           protein 5 protein.
          Length = 458

 Score = 40.7 bits (91), Expect = 6e-04
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V +A +L P D  G SDP+V I    N        +S K   LNPV+ E   F +P
Sbjct: 316 LYINVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIP 375

Query: 430 MSGTVNEDSLCLEVWDFD 483
            S  + E ++ ++V D+D
Sbjct: 376 -SSQIAETNILIQVMDWD 392



 Score = 35.9 bits (79), Expect = 0.016
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           +L + V+ A +L  +D     DP+V +YL+        T +   T +P + E FS  +S 
Sbjct: 184 VLMLHVIRANNLPVEDKGVTVDPYVKMYLLPERRGHCKTRICKKTNDPEFNEMFSFDVSF 243

Query: 436 GTVNEDSLCLEVWDFD 483
             +    L   V+DFD
Sbjct: 244 NNLANRMLQFTVYDFD 259


>Z92779-4|CAE11294.1| 1816|Caenorhabditis elegans Hypothetical protein
            ZK524.2e protein.
          Length = 1816

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 820  ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 876

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 877  T--DRIKVRVWDED 888


>Z92779-3|CAD90173.2| 2155|Caenorhabditis elegans Hypothetical protein
            ZK524.2d protein.
          Length = 2155

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 1159 ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 1215

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 1216 T--DRIKVRVWDED 1227


>Z92779-2|CAD56561.2| 1475|Caenorhabditis elegans Hypothetical
           protein ZK524.2c protein.
          Length = 1475

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 479 ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 535

Query: 442 VNEDSLCLEVWDFD 483
              D + + VWD D
Sbjct: 536 T--DRIKVRVWDED 547


>Z92779-1|CAB07173.1| 1813|Caenorhabditis elegans Hypothetical protein
            ZK524.2a protein.
          Length = 1813

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 817  ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 873

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 874  T--DRIKVRVWDED 885


>Z79694-11|CAE11299.1| 1816|Caenorhabditis elegans Hypothetical
            protein ZK524.2e protein.
          Length = 1816

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 820  ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 876

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 877  T--DRIKVRVWDED 888


>Z79694-10|CAD90170.2| 2155|Caenorhabditis elegans Hypothetical
            protein ZK524.2d protein.
          Length = 2155

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 1159 ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 1215

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 1216 T--DRIKVRVWDED 1227


>Z79694-9|CAB01966.1| 1813|Caenorhabditis elegans Hypothetical protein
            ZK524.2a protein.
          Length = 1813

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 817  ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 873

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 874  T--DRIKVRVWDED 885


>Z73912-7|CAE11317.1| 1816|Caenorhabditis elegans Hypothetical protein
            ZK524.2e protein.
          Length = 1816

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 820  ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 876

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 877  T--DRIKVRVWDED 888


>Z73912-6|CAD90190.2| 2155|Caenorhabditis elegans Hypothetical protein
            ZK524.2d protein.
          Length = 2155

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 1159 ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 1215

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 1216 T--DRIKVRVWDED 1227


>Z73912-5|CAD56619.2| 1475|Caenorhabditis elegans Hypothetical
           protein ZK524.2c protein.
          Length = 1475

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 479 ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 535

Query: 442 VNEDSLCLEVWDFD 483
              D + + VWD D
Sbjct: 536 T--DRIKVRVWDED 547


>Z73912-4|CAA98147.1| 1813|Caenorhabditis elegans Hypothetical protein
            ZK524.2a protein.
          Length = 1813

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 817  ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 873

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 874  T--DRIKVRVWDED 885


>M62830-1|AAA93094.1| 1815|Caenorhabditis elegans UNC-13 protein.
          Length = 1815

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 820  ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 876

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 877  T--DRIKVRVWDED 888


>AF077533-1|AAZ91357.1| 1126|Caenorhabditis elegans Hypothetical
            protein F54G2.1a protein.
          Length = 1126

 Score = 38.7 bits (86), Expect = 0.002
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 4/57 (7%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR----YNTSVKSGTLNPVWEEHF 420
            L ++++ A  ++  D NGLSDPFV I ++    +       T V S +LNP+++E F
Sbjct: 978  LVLDIIGAKQIIALDSNGLSDPFVVIEIIPKFRYPAVPVVKTKVVSKSLNPIFDETF 1034



 Score = 35.9 bits (79), Expect = 0.016
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPF 330
           ++LN+ ++EA DL+ KD NG SDPF
Sbjct: 98  VLLNILLLEAKDLIAKDVNGFSDPF 122



 Score = 34.7 bits (76), Expect = 0.038
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAE 492
           +SV+  TLNP W E F   +   V  D   +++WD D  E
Sbjct: 196 SSVQKKTLNPKWSEKFQFTVE-DVQRDQFHIDIWDHDDEE 234



 Score = 30.3 bits (65), Expect = 0.81
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +2

Query: 119 HNVGGCDVGCEVGQHAMLSYVQEAFKIGNDKHTQLLTKAEAKEPP 253
           H +G  DV  E  Q ++  YV+ AF+     H  L+ KA+  +PP
Sbjct: 54  HKLGQGDV--EESQESLYKYVRNAFQGDAAVHNALMEKAKQNKPP 96


>AF077533-2|AAP40529.1|  972|Caenorhabditis elegans Hypothetical
           protein F54G2.1b protein.
          Length = 972

 Score = 35.9 bits (79), Expect = 0.016
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPF 330
           ++LN+ ++EA DL+ KD NG SDPF
Sbjct: 114 VLLNILLLEAKDLIAKDVNGFSDPF 138



 Score = 34.7 bits (76), Expect = 0.038
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAE 492
           +SV+  TLNP W E F   +   V  D   +++WD D  E
Sbjct: 212 SSVQKKTLNPKWSEKFQFTVE-DVQRDQFHIDIWDHDDEE 250



 Score = 30.3 bits (65), Expect = 0.81
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +2

Query: 119 HNVGGCDVGCEVGQHAMLSYVQEAFKIGNDKHTQLLTKAEAKEPP 253
           H +G  DV  E  Q ++  YV+ AF+     H  L+ KA+  +PP
Sbjct: 70  HKLGQGDV--EESQESLYKYVRNAFQGDAAVHNALMEKAKQNKPP 112


>Z48809-1|CAA88745.1| 1299|Caenorhabditis elegans Hypothetical protein
            T01E8.3 protein.
          Length = 1299

 Score = 35.1 bits (77), Expect = 0.029
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPN-GLSDPFVTIYL--MSNSSHRYNT-SVKSGTLNPVWEEHFS 423
            + LNV+V+    L  KD N G+  PFV I +  M   +  + T ++ S  LNP+W + F+
Sbjct: 1060 IRLNVQVIGGRHLSRKDKNKGICSPFVEIEIIGMPCDTKVFQTKTIASNGLNPIWNQTFT 1119


>U13019-3|AAC24452.2|  713|Caenorhabditis elegans Hypothetical
           protein T12A2.15a protein.
          Length = 713

 Score = 33.1 bits (72), Expect = 0.12
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 4/79 (5%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKD----PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           ++ ++++EA +L  +D      G SDP+  I +    S  + T      LNP+W E+F  
Sbjct: 277 VVRLKIIEAKNLENRDISFIKKGKSDPYAEIQV---GSQFFKTRTIDDDLNPIWNEYFEA 333

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +    +   L +E++D D
Sbjct: 334 VVD-QADGQKLRIELFDED 351


>U41016-5|AAP46274.1|  811|Caenorhabditis elegans Hypothetical
           protein R11G1.6c protein.
          Length = 811

 Score = 29.9 bits (64), Expect = 1.1
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 316 LSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           +S PFV +  M   + +Y+T+ K    NP WEE F   ++    E
Sbjct: 330 VSQPFVNVE-MDEPAQKYSTT-KGINANPFWEETFDFDLTPATEE 372


>U41016-4|AAP46275.1|  809|Caenorhabditis elegans Hypothetical
           protein R11G1.6d protein.
          Length = 809

 Score = 29.9 bits (64), Expect = 1.1
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 316 LSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           +S PFV +  M   + +Y+T+ K    NP WEE F   ++    E
Sbjct: 330 VSQPFVNVE-MDEPAQKYSTT-KGINANPFWEETFDFDLTPATEE 372


>U41016-3|AAM51497.1|  901|Caenorhabditis elegans Hypothetical
           protein R11G1.6b protein.
          Length = 901

 Score = 29.9 bits (64), Expect = 1.1
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 316 LSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           +S PFV +  M   + +Y+T+ K    NP WEE F   ++    E
Sbjct: 420 VSQPFVNVE-MDEPAQKYSTT-KGINANPFWEETFDFDLTPATEE 462


>U41016-2|AAM51496.1|  899|Caenorhabditis elegans Hypothetical
           protein R11G1.6a protein.
          Length = 899

 Score = 29.9 bits (64), Expect = 1.1
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 316 LSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           +S PFV +  M   + +Y+T+ K    NP WEE F   ++    E
Sbjct: 420 VSQPFVNVE-MDEPAQKYSTT-KGINANPFWEETFDFDLTPATEE 462


>Z81564-9|CAB04575.1|  724|Caenorhabditis elegans Hypothetical
           protein K05C4.9 protein.
          Length = 724

 Score = 28.3 bits (60), Expect = 3.3
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = -1

Query: 312 IRVFRN*ICGFDHL--DIQHQPGGSLASALVRSCVCLSLPILNASCTYDSIACC 157
           +RV  N I  FDHL  +       S+ SA +++ V L L I+N     D+  CC
Sbjct: 416 LRVLLNFIHNFDHLGSNFTQYLRNSIWSA-IQTLVTLDLSIINYDDVCDAAVCC 468


>Z73911-4|CAA98141.2|  625|Caenorhabditis elegans Hypothetical
           protein T12A7.1 protein.
          Length = 625

 Score = 27.5 bits (58), Expect = 5.7
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 3/39 (7%)
 Frame = +1

Query: 301 KDPNGLSDPFVTIYLM--SNSSHR-YNTSVKSGTLNPVW 408
           KD  G SDP++         SSH  + T VK  TLNP W
Sbjct: 189 KDFFGKSDPYLNFKRRFDDGSSHMIHQTEVKPKTLNPRW 227


>Z46933-4|CAA87037.1|  452|Caenorhabditis elegans Hypothetical
           protein F34H10.4 protein.
          Length = 452

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 11/23 (47%), Positives = 18/23 (78%)
 Frame = -2

Query: 104 VFPSIVHQYSSQLPRLSVLSYHV 36
           +FP+ +HQ S+ L +LSV +Y+V
Sbjct: 52  MFPNTLHQVSNFLEKLSVQAYNV 74


>AC024847-5|AAN73850.1|  792|Caenorhabditis elegans Ww domain
           protein (e3 ubiquitinligase) protein 1, isoform b
           protein.
          Length = 792

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +D +V I   ++S+    T+VK  T+ P W EH ++
Sbjct: 45  ADCYVEITSDTSSAAPKKTTVKKKTMAPEWNEHLNV 80


>AC024847-4|AAN73849.1|  794|Caenorhabditis elegans Ww domain
           protein (e3 ubiquitinligase) protein 1, isoform a
           protein.
          Length = 794

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +D +V I   ++S+    T+VK  T+ P W EH ++
Sbjct: 45  ADCYVEITSDTSSAAPKKTTVKKKTMAPEWNEHLNV 80


>AC006816-6|ABA00154.1|  506|Caenorhabditis elegans Hypothetical
           protein Y71D11A.1 protein.
          Length = 506

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = -1

Query: 279 DHLDIQHQPGGSLASALVRSCVCLSLPI 196
           DHL I     GS A+ LVR    LSLP+
Sbjct: 80  DHLVIDRSDPGSSATWLVRLSASLSLPV 107


>Z78019-2|CAB01451.1|  347|Caenorhabditis elegans Hypothetical
           protein ZK863.5 protein.
          Length = 347

 Score = 26.6 bits (56), Expect = 10.0
 Identities = 15/28 (53%), Positives = 17/28 (60%)
 Frame = -2

Query: 332 TNGSLRPFGSLGTKSVASTTSTFSINPE 249
           TN S+  FGS    SVAS TS F+I  E
Sbjct: 317 TNSSM--FGSFDNSSVASVTSKFTITLE 342


>Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical
           protein C03D6.4 protein.
          Length = 1390

 Score = 26.6 bits (56), Expect = 10.0
 Identities = 19/54 (35%), Positives = 24/54 (44%)
 Frame = -2

Query: 440 VPDMGKEKCSSQTGFRVPDFTDVLYRCDEFDIK*IVTNGSLRPFGSLGTKSVAS 279
           + DMG     +  G       DV    D FDIK I T+ S+ PF  L T  V +
Sbjct: 101 INDMGVNSDGTVLGVLHTKNNDV--SVDVFDIKKICTSSSIEPFKPLCTTRVGT 152


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,795,707
Number of Sequences: 27780
Number of extensions: 234714
Number of successful extensions: 790
Number of sequences better than 10.0: 50
Number of HSP's better than 10.0 without gapping: 730
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 769
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 945973702
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).