SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z12017-1|CAA78047.1|  458|Caenorhabditis elegans Hypothetical pr...    31   0.61 
U64833-8|AAB04820.1|  432|Caenorhabditis elegans Hypothetical pr...    31   0.61 
Z66521-16|CAA91396.2|  793|Caenorhabditis elegans Hypothetical p...    30   1.4  
AF188715-1|AAF05590.1|  793|Caenorhabditis elegans alanyl-tRNA s...    30   1.4  
AF067622-4|ABD63224.1|  338|Caenorhabditis elegans Hypothetical ...    29   2.5  
AF067622-3|ABD63225.1|  447|Caenorhabditis elegans Hypothetical ...    29   2.5  
Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical pr...    29   3.3  
M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-re...    29   3.3  
U40953-3|AAB52650.1|  342|Caenorhabditis elegans Hypothetical pr...    28   5.7  
AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical...    28   7.6  
AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical ...    28   7.6  

>Z12017-1|CAA78047.1|  458|Caenorhabditis elegans Hypothetical
           protein R08D7.1 protein.
          Length = 458

 Score = 31.5 bits (68), Expect = 0.61
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = -2

Query: 539 RTKRNRHDLRQEDPRKAGERGSGSSPKRK 453
           RT+R+RHD     PR    R S +SP R+
Sbjct: 182 RTRRDRHDSDNSPPRNRSRRDSDNSPPRR 210


>U64833-8|AAB04820.1|  432|Caenorhabditis elegans Hypothetical
           protein B0507.3 protein.
          Length = 432

 Score = 31.5 bits (68), Expect = 0.61
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -2

Query: 347 PAPVRIRFPSKPDTPRSSEPILIPKLRIQFATS 249
           P P  ++  SKP TP  + P+L+P++ +   TS
Sbjct: 324 PNPAMVQKSSKPSTPIPAPPVLVPQVELPAKTS 356


>Z66521-16|CAA91396.2|  793|Caenorhabditis elegans Hypothetical
           protein W02B12.6a protein.
          Length = 793

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = -2

Query: 572 LNGGRTESCRSRTKRNRHDLRQEDPRKAGERGSGSSPKRKTI 447
           L G    +CR+ TK    DLR  DP++  + G     KR  I
Sbjct: 738 LTGKEAAACRNYTKSIYEDLRSTDPKERSKTGKNIDWKRVPI 779


>AF188715-1|AAF05590.1|  793|Caenorhabditis elegans alanyl-tRNA
           synthetase protein.
          Length = 793

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = -2

Query: 572 LNGGRTESCRSRTKRNRHDLRQEDPRKAGERGSGSSPKRKTI 447
           L G    +CR+ TK    DLR  DP++  + G     KR  I
Sbjct: 738 LTGKEAAACRNYTKSIYEDLRSTDPKERSKTGKNIDWKRVPI 779


>AF067622-4|ABD63224.1|  338|Caenorhabditis elegans Hypothetical
           protein F33E11.6a protein.
          Length = 338

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = -3

Query: 367 RTNIDQTRHRSASASRPNPTRPGPQSQSL 281
           +TNI Q+R  S    +P  TRPGP   +L
Sbjct: 213 QTNIIQSRRNSWKVMKPEATRPGPYPVAL 241


>AF067622-3|ABD63225.1|  447|Caenorhabditis elegans Hypothetical
           protein F33E11.6b protein.
          Length = 447

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = -3

Query: 367 RTNIDQTRHRSASASRPNPTRPGPQSQSL 281
           +TNI Q+R  S    +P  TRPGP   +L
Sbjct: 213 QTNIIQSRRNSWKVMKPEATRPGPYPVAL 241


>Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical
           protein F29D11.1 protein.
          Length = 4753

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = +3

Query: 588 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCSE 686
           W+  G   C+ + K CDG + C       QCS+
Sbjct: 267 WNCPGTGHCIDQLKLCDGSKDCADGADEQQCSQ 299


>M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL
           receptor-related protein protein.
          Length = 4753

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = +3

Query: 588 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCSE 686
           W+  G   C+ + K CDG + C       QCS+
Sbjct: 267 WNCPGTGHCIDQLKLCDGSKDCADGADEQQCSQ 299


>U40953-3|AAB52650.1|  342|Caenorhabditis elegans Hypothetical
           protein F53B1.4 protein.
          Length = 342

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 4/42 (9%)
 Frame = -3

Query: 361 NIDQTRHRSASASRPNPTRPGPQSQS----LFRSYGSNLPLP 248
           + + T  +S SAS PNPT P   S++    + RSY  +  LP
Sbjct: 144 SFEDTTPKSESASLPNPTNPYAASKAACEMVIRSYWHSYKLP 185


>AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3c protein.
          Length = 435

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = -1

Query: 603 PLVRASSELTVERRSYR---IVPIAHETKPTRLTAGRSAEGRRTRVRIQSET*DDFRECH 433
           P   A  ELT E R  R   I+ IA +T+P  L    SA G    VRI +++    R   
Sbjct: 9   PPKNAKLELTAEERDQRTLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDS-RTGRSKG 67

Query: 432 IKYIQF 415
           I Y++F
Sbjct: 68  ICYVEF 73


>AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3a protein.
          Length = 580

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = -1

Query: 603 PLVRASSELTVERRSYR---IVPIAHETKPTRLTAGRSAEGRRTRVRIQSET*DDFRECH 433
           P   A  ELT E R  R   I+ IA +T+P  L    SA G    VRI +++    R   
Sbjct: 154 PPKNAKLELTAEERDQRTLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDS-RTGRSKG 212

Query: 432 IKYIQF 415
           I Y++F
Sbjct: 213 ICYVEF 218


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,860,549
Number of Sequences: 27780
Number of extensions: 411656
Number of successful extensions: 1424
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1225
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1424
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1655655746
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).