SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0105
         (697 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF040661-12|AAG24221.1|  210|Caenorhabditis elegans Hypothetical...    30   1.4  
Z70037-4|CAA93877.1|  146|Caenorhabditis elegans Hypothetical pr...    30   1.8  
Z81094-5|CAB03149.2|  675|Caenorhabditis elegans Hypothetical pr...    29   2.4  
AF536544-1|AAN77185.1|  675|Caenorhabditis elegans SR-related CT...    29   2.4  
Z81048-1|CAB02839.1|  587|Caenorhabditis elegans Hypothetical pr...    29   4.2  
AB033380-1|BAA92264.1|  587|Caenorhabditis elegans kinesin like ...    29   4.2  
Z70682-6|CAH60781.2|  401|Caenorhabditis elegans Hypothetical pr...    28   7.3  
Z48006-3|CAB62803.1|  449|Caenorhabditis elegans Hypothetical pr...    28   7.3  
Z48006-2|CAA88050.1|  495|Caenorhabditis elegans Hypothetical pr...    28   7.3  

>AF040661-12|AAG24221.1|  210|Caenorhabditis elegans Hypothetical
           protein W10G11.14 protein.
          Length = 210

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = +1

Query: 397 EPQFRTFGSCTRPSGRWCELPSAGLCLNASKAEASLANPARICSLWSPESR-EALNNVTL 573
           EP ++ F    RPSG WC    AG   NA KA+A  +  A   +L   +++ EAL   T 
Sbjct: 41  EPGWKFFN---RPSGGWCMRVFAG--FNAKKADAEKSCQAVGSTLSGIQNKNEALYIQTA 95

Query: 574 LVAFRIQNARRDVEAHLDRGDRCYR 648
           L+A +I  +   V   + R  +C +
Sbjct: 96  LLA-QIPQSSGSVWIGIQRTQKCLK 119


>Z70037-4|CAA93877.1|  146|Caenorhabditis elegans Hypothetical
           protein T27D12.3 protein.
          Length = 146

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +1

Query: 430 RPSGRWCELPSAGLCLNASKAEASLANPARICSLWSPESREALNNVT 570
           RPSG WC     GL L  ++ EAS    A    L   +++  LN +T
Sbjct: 35  RPSGPWCVKLFVGLYLQGNRNEASARCAAEGAVLSGVQNQAELNAMT 81


>Z81094-5|CAB03149.2|  675|Caenorhabditis elegans Hypothetical
           protein F58G11.5 protein.
          Length = 675

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = -3

Query: 533 HSEHILAGLARLASALEAFRHNPADGSSHHRP 438
           +S+HI   +  +   ++ FRH P+ G + H P
Sbjct: 279 YSQHIQRQIDEVERKIDEFRHGPSSGPASHHP 310


>AF536544-1|AAN77185.1|  675|Caenorhabditis elegans SR-related CTD
           associated factor 6 protein.
          Length = 675

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = -3

Query: 533 HSEHILAGLARLASALEAFRHNPADGSSHHRP 438
           +S+HI   +  +   ++ FRH P+ G + H P
Sbjct: 279 YSQHIQRQIDEVERKIDEFRHGPSSGPASHHP 310


>Z81048-1|CAB02839.1|  587|Caenorhabditis elegans Hypothetical
           protein C41G7.2 protein.
          Length = 587

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = -1

Query: 553 PPDSRGSTVSISLPDWLGWLRP*RRSGIIPRMVVRTTGRSAECMNQMSE 407
           PP ++ ST + SL   +   RP  +  I+P  V     R+A+   +M+E
Sbjct: 119 PPSTQRSTATFSLKPSVARARPVAQKPILPSKVTLLEERNAQLEREMAE 167


>AB033380-1|BAA92264.1|  587|Caenorhabditis elegans kinesin like
           protein protein.
          Length = 587

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = -1

Query: 553 PPDSRGSTVSISLPDWLGWLRP*RRSGIIPRMVVRTTGRSAECMNQMSE 407
           PP ++ ST + SL   +   RP  +  I+P  V     R+A+   +M+E
Sbjct: 119 PPSTQRSTATFSLKPSVARARPVAQKPILPSKVTLLEERNAQLEREMAE 167


>Z70682-6|CAH60781.2|  401|Caenorhabditis elegans Hypothetical
           protein F08G5.7 protein.
          Length = 401

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/37 (29%), Positives = 16/37 (43%)
 Frame = +1

Query: 445 WCELPSAGLCLNASKAEASLANPARICSLWSPESREA 555
           W + P  G C   S AE+       IC   +P++  A
Sbjct: 77  WHQFPDTGCCYRVSDAESEWHGGTAICKALNPDAEMA 113


>Z48006-3|CAB62803.1|  449|Caenorhabditis elegans Hypothetical
           protein F19C6.2b protein.
          Length = 449

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +3

Query: 540 RESGGSKQCDFTSRVSHSKRET---RRRSPFGSRRSMLSVFFLTRASRLRSPD 689
           RES  S   D +S   ++K++    ++R+ FG +R + ++   T+ S    PD
Sbjct: 295 RESDCSGNEDDSSNAKYAKKQVFKKKKRNAFGKKRELAAILDHTKPSEHSEPD 347


>Z48006-2|CAA88050.1|  495|Caenorhabditis elegans Hypothetical
           protein F19C6.2a protein.
          Length = 495

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +3

Query: 540 RESGGSKQCDFTSRVSHSKRET---RRRSPFGSRRSMLSVFFLTRASRLRSPD 689
           RES  S   D +S   ++K++    ++R+ FG +R + ++   T+ S    PD
Sbjct: 341 RESDCSGNEDDSSNAKYAKKQVFKKKKRNAFGKKRELAAILDHTKPSEHSEPD 393


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,156,132
Number of Sequences: 27780
Number of extensions: 331182
Number of successful extensions: 856
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 826
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 856
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1602927856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).