SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical ...    29   1.5  
AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical ...    29   1.5  
AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.    29   1.5  
AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.    29   1.5  
Z68296-5|CAD59142.2| 1677|Caenorhabditis elegans Hypothetical pr...    29   2.0  
Z68296-4|CAA92591.3| 1838|Caenorhabditis elegans Hypothetical pr...    29   2.0  
U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical pr...    29   2.6  
AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical ...    29   2.6  
Z69635-6|CAA93461.1|  695|Caenorhabditis elegans Hypothetical pr...    28   4.5  
U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical pr...    27   6.0  
U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical pr...    27   6.0  
AL021482-3|CAA16340.3| 1499|Caenorhabditis elegans Hypothetical ...    27   6.0  
AF177199-1|AAK81894.1| 1455|Caenorhabditis elegans mutant dosage...    27   6.0  
Z83238-6|CAB05800.1|  943|Caenorhabditis elegans Hypothetical pr...    27   7.9  
Z81531-5|CAB04319.1| 1152|Caenorhabditis elegans Hypothetical pr...    27   7.9  
Z81513-13|CAB04180.2| 1213|Caenorhabditis elegans Hypothetical p...    27   7.9  
Z81042-7|CAE46660.1|  371|Caenorhabditis elegans Hypothetical pr...    27   7.9  
Z73976-9|CAA98280.2|  371|Caenorhabditis elegans Hypothetical pr...    27   7.9  
U61948-8|AAB03147.2|  782|Caenorhabditis elegans Human hcf1 rela...    27   7.9  
AF072907-1|AAD12580.1|  782|Caenorhabditis elegans host cell fac...    27   7.9  

>AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical
           protein H30A04.1b protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPAD-----IIDRAPLPPNRVSNETM 304
           T+T++  T P  T+  TH+ P++      + RAPL P  + + T+
Sbjct: 434 TSTTLMVTQPTVTVSPTHQVPSEPFVGFTVTRAPLRPLDIGSTTL 478


>AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical
           protein H30A04.1a protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPAD-----IIDRAPLPPNRVSNETM 304
           T+T++  T P  T+  TH+ P++      + RAPL P  + + T+
Sbjct: 434 TSTTLMVTQPTVTVSPTHQVPSEPFVGFTVTRAPLRPLDIGSTTL 478


>AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPAD-----IIDRAPLPPNRVSNETM 304
           T+T++  T P  T+  TH+ P++      + RAPL P  + + T+
Sbjct: 434 TSTTLMVTQPTVTVSPTHQVPSEPFVGFTVTRAPLRPLDIGSTTL 478


>AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPAD-----IIDRAPLPPNRVSNETM 304
           T+T++  T P  T+  TH+ P++      + RAPL P  + + T+
Sbjct: 434 TSTTLMVTQPTVTVSPTHQVPSEPFVGFTVTRAPLRPLDIGSTTL 478


>Z68296-5|CAD59142.2| 1677|Caenorhabditis elegans Hypothetical protein
            C46C2.1b protein.
          Length = 1677

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 20/70 (28%), Positives = 37/70 (52%)
 Frame = -3

Query: 405  ATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNA 226
            +  P+ T  ++  + A +I      P  +++E    V+ Q  + + I+HL+TP  SP + 
Sbjct: 1136 SADPIATPISSSISTATVIPIVAATPTNITSEP---VIVQPITAQVITHLATP--SPVSH 1190

Query: 225  RLESSSTGSA 196
             L S+S+ SA
Sbjct: 1191 SLSSNSSPSA 1200


>Z68296-4|CAA92591.3| 1838|Caenorhabditis elegans Hypothetical protein
            C46C2.1a protein.
          Length = 1838

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 20/70 (28%), Positives = 37/70 (52%)
 Frame = -3

Query: 405  ATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNA 226
            +  P+ T  ++  + A +I      P  +++E    V+ Q  + + I+HL+TP  SP + 
Sbjct: 1136 SADPIATPISSSISTATVIPIVAATPTNITSEP---VIVQPITAQVITHLATP--SPVSH 1190

Query: 225  RLESSSTGSA 196
             L S+S+ SA
Sbjct: 1191 SLSSNSSPSA 1200


>U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical
           protein C12D12.1b protein.
          Length = 648

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 25/92 (27%), Positives = 35/92 (38%)
 Frame = -3

Query: 429 F*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLST 250
           F   T+VS  SP  T+ T    P  +      PP   +  T   V     S    ++L+T
Sbjct: 469 FYPVTTVSTMSPPTTV-TVPTTPTPVPTTTNTPPANPTTATPTTVGTIGTSPTAPANLTT 527

Query: 249 PLMSPYNARLESSSTGSAFPADSPKPVPLAVV 154
           P  +P N    SS+T    P +   P     V
Sbjct: 528 PTTAPVNP--TSSTTAPTAPVNPTSPTTAPTV 557


>AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical
           protein ZC190.4 protein.
          Length = 629

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 13/44 (29%), Positives = 25/44 (56%)
 Frame = -3

Query: 375 THRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPL 244
           T +   DIID   +P N +S++ +  +++  R  E ++H+  PL
Sbjct: 289 TRKTSTDIIDGFNVPSNMISDDNLPALIY--RVIETLNHMIFPL 330


>Z69635-6|CAA93461.1|  695|Caenorhabditis elegans Hypothetical
           protein F19B6.4 protein.
          Length = 695

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 1/46 (2%)
 Frame = -2

Query: 493 TDVPPQSNSPP-GSVLEPDHAGVLNGDERFRHVTTLHAWNDTPCAR 359
           T +P   N  P  S +E     + +  ERFR   TL   NDT  AR
Sbjct: 42  TPIPVLINDTPVASEIEQVEKELAHSSERFRKPKTLSVTNDTESAR 87


>U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical
           protein C12D12.1a protein.
          Length = 769

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNET 307
           T+ +   TSP  T+GT+  APA++      P N  S+ T
Sbjct: 623 TSPTKLPTSPPSTVGTSPTAPANLTTPTTAPVNPTSSTT 661


>U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical
           protein C12D12.1c protein.
          Length = 825

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNET 307
           T+ +   TSP  T+GT+  APA++      P N  S+ T
Sbjct: 679 TSPTKLPTSPPSTVGTSPTAPANLTTPTTAPVNPTSSTT 717


>AL021482-3|CAA16340.3| 1499|Caenorhabditis elegans Hypothetical
            protein Y39A1B.3 protein.
          Length = 1499

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 17/74 (22%), Positives = 31/74 (41%)
 Frame = -3

Query: 402  TSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNAR 223
            T+P  T    H   + + D+    PN++    + +VV+  R +   + +       Y   
Sbjct: 1093 TTPGATSNDLHHLVSVMCDKRLFVPNKLMGRLLPIVVYGMRCKIMPTRIRHAATVAYGKM 1152

Query: 222  LESSSTGSAFPADS 181
            +  S+  SAF A S
Sbjct: 1153 MPLSAEISAFAAPS 1166


>AF177199-1|AAK81894.1| 1455|Caenorhabditis elegans mutant dosage
            compensation protein protein.
          Length = 1455

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 17/74 (22%), Positives = 31/74 (41%)
 Frame = -3

Query: 402  TSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNAR 223
            T+P  T    H   + + D+    PN++    + +VV+  R +   + +       Y   
Sbjct: 1049 TTPGATSNDLHHLVSVMCDKRLFVPNKLMGRLLPIVVYGMRCKIMPTRIRHAATVAYGKM 1108

Query: 222  LESSSTGSAFPADS 181
            +  S+  SAF A S
Sbjct: 1109 MPLSAEISAFAAPS 1122


>Z83238-6|CAB05800.1|  943|Caenorhabditis elegans Hypothetical
           protein T08G3.7 protein.
          Length = 943

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 6/30 (20%)
 Frame = +3

Query: 138 IYYLAKPQPRERAW------ENQRGKQTLL 209
           +YY  KP   ER W      +NQ GK TLL
Sbjct: 589 LYYFGKPLDYERRWRYSLFLDNQDGKNTLL 618


>Z81531-5|CAB04319.1| 1152|Caenorhabditis elegans Hypothetical
           protein F36D3.5 protein.
          Length = 1152

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 6/30 (20%)
 Frame = +3

Query: 138 IYYLAKPQPRERAW------ENQRGKQTLL 209
           +YY  KP   ER W      +NQ GK TLL
Sbjct: 790 LYYFGKPLDYERRWRYSLFLDNQGGKNTLL 819


>Z81513-13|CAB04180.2| 1213|Caenorhabditis elegans Hypothetical
           protein F26D2.10 protein.
          Length = 1213

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 6/30 (20%)
 Frame = +3

Query: 138 IYYLAKPQPRERAW------ENQRGKQTLL 209
           +YY  KP   ER W      +NQ GK TLL
Sbjct: 851 LYYFGKPLDYERRWRYSLFLDNQDGKNTLL 880


>Z81042-7|CAE46660.1|  371|Caenorhabditis elegans Hypothetical
           protein T07C12.11 protein.
          Length = 371

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +3

Query: 81  PRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKQTLL 209
           P H ++D    I ++ ++ I Y  +P   ER W++ R K   L
Sbjct: 38  PLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMRDKYVRL 80


>Z73976-9|CAA98280.2|  371|Caenorhabditis elegans Hypothetical
           protein T07C12.11 protein.
          Length = 371

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +3

Query: 81  PRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKQTLL 209
           P H ++D    I ++ ++ I Y  +P   ER W++ R K   L
Sbjct: 38  PLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMRDKYVRL 80


>U61948-8|AAB03147.2|  782|Caenorhabditis elegans Human hcf1 related
           protein 1 protein.
          Length = 782

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 3/73 (4%)
 Frame = -3

Query: 480 PSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPAD---IIDRAPLPPNRVSNE 310
           P + P +   S + T +       +A S + T GTT+ APAD     D   LP +   + 
Sbjct: 432 PRKQPSIVPPSQKETEQSPKKPQGTAPSIISTQGTTYTAPADPKPATDEGGLPQDLFEDT 491

Query: 309 TMKVVVFQRRSRE 271
                   +RS +
Sbjct: 492 EKNETASPKRSND 504


>AF072907-1|AAD12580.1|  782|Caenorhabditis elegans host cell factor
           1 protein.
          Length = 782

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 3/73 (4%)
 Frame = -3

Query: 480 PSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPAD---IIDRAPLPPNRVSNE 310
           P + P +   S + T +       +A S + T GTT+ APAD     D   LP +   + 
Sbjct: 432 PRKQPSIVPPSQKETEQSPKKPQGTAPSIISTQGTTYTAPADPKPATDEGGLPQDLFEDT 491

Query: 309 TMKVVVFQRRSRE 271
                   +RS +
Sbjct: 492 EKNETASPKRSND 504


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,967,900
Number of Sequences: 27780
Number of extensions: 250954
Number of successful extensions: 831
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 747
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 831
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 988489374
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).