SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z96102-2|CAI79216.1|  746|Caenorhabditis elegans Hypothetical pr...    32   0.30 
Z48583-4|CAN99691.1| 3394|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z48583-3|CAA88472.1| 3396|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr...    29   3.7  
Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p...    29   3.7  
AL033536-1|CAA22138.1|  908|Caenorhabditis elegans Hypothetical ...    28   6.5  
U28738-10|AAK72066.3|  208|Caenorhabditis elegans Sr protein (sp...    27   8.6  
L14433-3|AAA27977.1| 2329|Caenorhabditis elegans Yeast prp (spli...    27   8.6  

>Z96102-2|CAI79216.1|  746|Caenorhabditis elegans Hypothetical
           protein H39E23.3 protein.
          Length = 746

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 5/60 (8%)
 Frame = -1

Query: 371 APVKLPAWQCPRTGSRGSFKR----RRAFPPRHHSARLERNTVARRYY-RPRTASAQPSK 207
           APVK  A + P+T S  S K+    R A PP+  SA  E+N  A+R   +P+T SA   K
Sbjct: 525 APVKREADK-PKTESADSEKKAPAKREADPPKTESADSEKNAPAKREADKPKTESADSEK 583



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 5/60 (8%)
 Frame = -1

Query: 371 APVKLPAWQCPRTGSRGSFKR----RRAFPPRHHSARLERNTVARRYY-RPRTASAQPSK 207
           APVK  A + P+T S  S K+    R A PP+  SA  E+N  A+R   +P+T SA   K
Sbjct: 645 APVKREADK-PKTESADSEKKAPAKREADPPKTESADSEKNAPAKREADKPKTESADSEK 703


>Z48583-4|CAN99691.1| 3394|Caenorhabditis elegans Hypothetical protein
            F54B3.1b protein.
          Length = 3394

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -3

Query: 180  FSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKP 61
            F DD  K     ++   S  +   ESSSTGSS  +D P+P
Sbjct: 1429 FLDDEEKTITDNSSSASSEDSDSDESSSTGSSSSSDDPRP 1468


>Z48583-3|CAA88472.1| 3396|Caenorhabditis elegans Hypothetical protein
            F54B3.1a protein.
          Length = 3396

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -3

Query: 180  FSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKP 61
            F DD  K     ++   S  +   ESSSTGSS  +D P+P
Sbjct: 1429 FLDDEEKTITDNSSSASSEDSDSDESSSTGSSSSSDDPRP 1468


>Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 21/77 (27%), Positives = 37/77 (48%)
 Frame = -2

Query: 388 SLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPWPADIIDRAPLPPNRV 209
           +++D    S+SP  +    D    L+ D+    + +  +WNET    D I+  PLP N +
Sbjct: 729 TISDTSTTSSSPSSTTA--DSTSTLSVDQFDFILDSGLSWNETRHNEDSINIVPLPTNAI 786

Query: 208 SNETMKVVVFQRRSRET 158
           +  T +   F+ R+  T
Sbjct: 787 T-PTERSQTFECRNVST 802


>Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 21/77 (27%), Positives = 37/77 (48%)
 Frame = -2

Query: 388 SLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPWPADIIDRAPLPPNRV 209
           +++D    S+SP  +    D    L+ D+    + +  +WNET    D I+  PLP N +
Sbjct: 729 TISDTSTTSSSPSSTTA--DSTSTLSVDQFDFILDSGLSWNETRHNEDSINIVPLPTNAI 786

Query: 208 SNETMKVVVFQRRSRET 158
           +  T +   F+ R+  T
Sbjct: 787 T-PTERSQTFECRNVST 802


>AL033536-1|CAA22138.1|  908|Caenorhabditis elegans Hypothetical
           protein Y53C10A.4 protein.
          Length = 908

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 5/44 (11%)
 Frame = -3

Query: 177 SDDRAKRSPTYATP----LMSPYNARLESSSTGSSFPAD-SPKP 61
           +DD   R P + +     L  PY +   SSS+ SS P+D +P+P
Sbjct: 681 NDDSDSRFPAFKSSSVAMLTEPYKSSSSSSSSTSSIPSDPAPRP 724


>U28738-10|AAK72066.3|  208|Caenorhabditis elegans Sr protein
           (splicing factor) protein5, isoform d protein.
          Length = 208

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 23/76 (30%), Positives = 32/76 (42%)
 Frame = -1

Query: 341 PRTGSRGSFKRRRAFPPRHHSARLERNTVARRYYRPRTASAQPSK**NNESSGFSATIAR 162
           PR  SR S +RR   PPR  S   +R    R   R  + S  P +     S   S +  +
Sbjct: 87  PRRRSR-SPRRRSRTPPRRRSRSRDRKRSRRSRSRSSSRSRSPVRESRRRSESRSPS-PK 144

Query: 161 NDLPLMLHLSCLLTMP 114
            DL L  ++S   + P
Sbjct: 145 RDLQLRANISVSYSSP 160


>L14433-3|AAA27977.1| 2329|Caenorhabditis elegans Yeast prp (splicing
            factor) relatedprotein 8 protein.
          Length = 2329

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/70 (21%), Positives = 36/70 (51%)
 Frame = -2

Query: 445  FAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWN 266
            + P+E+  L  L++GH+    +D+     +  G V     +G+ + +++   +  L+ + 
Sbjct: 1309 YTPKEIGGLGMLSMGHVLIPQSDLRWMQQTEAGGVTH-FRSGMSHDEDQL--IPNLYRYI 1365

Query: 265  ETPWPADIID 236
            + PW A+ +D
Sbjct: 1366 Q-PWEAEFVD 1374


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,204,907
Number of Sequences: 27780
Number of extensions: 332252
Number of successful extensions: 1014
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 955
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1013
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1423653030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).