SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical pr...    32   0.33 
U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical pr...    32   0.33 
AL032623-17|CAN86638.1| 1398|Caenorhabditis elegans Hypothetical...    32   0.33 
AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical...    32   0.33 
Z50029-1|CAA90340.2|  460|Caenorhabditis elegans Hypothetical pr...    28   7.1  
U41992-4|AAL02506.2|  876|Caenorhabditis elegans Hypothetical pr...    28   7.1  
Z66494-1|CAA91262.2|  320|Caenorhabditis elegans Hypothetical pr...    27   9.4  
Z35662-1|CAA84721.1| 4307|Caenorhabditis elegans Hypothetical pr...    27   9.4  
Z35599-4|CAA84661.1| 4307|Caenorhabditis elegans Hypothetical pr...    27   9.4  
Z34802-10|CAA84339.1| 4307|Caenorhabditis elegans Hypothetical p...    27   9.4  
U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical pr...    27   9.4  

>U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical
           protein C12D12.1a protein.
          Length = 769

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 23/90 (25%), Positives = 37/90 (41%)
 Frame = -1

Query: 411 TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPL 232
           T+ +   TSP  T+GT   APA++      P N  S+ T         S  T PT   P+
Sbjct: 623 TSPTKLPTSPPSTVGTSPTAPANLTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPT-VPPV 681

Query: 231 MSPYNARLESSSTGSSFPADSPKPVPLAVV 142
            +       S++T ++    + +  P   V
Sbjct: 682 TTTTPTTTTSTTTTTTTTTTTTQTTPTTPV 711


>U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical
           protein C12D12.1c protein.
          Length = 825

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 23/90 (25%), Positives = 37/90 (41%)
 Frame = -1

Query: 411 TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPL 232
           T+ +   TSP  T+GT   APA++      P N  S+ T         S  T PT   P+
Sbjct: 679 TSPTKLPTSPPSTVGTSPTAPANLTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPT-VPPV 737

Query: 231 MSPYNARLESSSTGSSFPADSPKPVPLAVV 142
            +       S++T ++    + +  P   V
Sbjct: 738 TTTTPTTTTSTTTTTTTTTTTTQTTPTTPV 767


>AL032623-17|CAN86638.1| 1398|Caenorhabditis elegans Hypothetical
           protein Y43F8B.3b protein.
          Length = 1398

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 14/34 (41%), Positives = 18/34 (52%)
 Frame = -2

Query: 527 FLSSLSCLRTPALFVDRCTAPVKLPAWQCPRTGS 426
           FL+   C  T  +F + C  P+ LPA  C  TGS
Sbjct: 735 FLTQEDCAATCDVFTNPCNQPIALPATLCSGTGS 768


>AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical
            protein Y43F8B.3a protein.
          Length = 1816

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 14/34 (41%), Positives = 18/34 (52%)
 Frame = -2

Query: 527  FLSSLSCLRTPALFVDRCTAPVKLPAWQCPRTGS 426
            FL+   C  T  +F + C  P+ LPA  C  TGS
Sbjct: 1153 FLTQEDCAATCDVFTNPCNQPIALPATLCSGTGS 1186


>Z50029-1|CAA90340.2|  460|Caenorhabditis elegans Hypothetical
           protein ZC504.1 protein.
          Length = 460

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = -2

Query: 539 LHARFLSSLSCLRTPALFVDRCTAPVKLPAWQCPRTGSR 423
           L  RF  S +CL   +L + R ++PV     +CP TG R
Sbjct: 48  LCTRFCQSTACLAGQSLLLARDSSPVNCKDMECP-TGYR 85


>U41992-4|AAL02506.2|  876|Caenorhabditis elegans Hypothetical protein
            F32E10.3 protein.
          Length = 876

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 6/97 (6%)
 Frame = -1

Query: 447  AVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRR 268
            AV+    T E  + T+  +T P     T   AP+       +   +VS E M+ +V +  
Sbjct: 751  AVTPAPTTSEKTSTTAAPSTKPAEETTTTTEAPSTTTKPVTVAVKKVSPEEMEKLVKKES 810

Query: 267  SRETT-----PTYATPLMSPYN-ARLESSSTGSSFPA 175
            + + T     PT+  P ++P+    L + +T    PA
Sbjct: 811  TEKVTLLPPLPTFTFPTLAPFTFPTLPTLATTKPSPA 847


>Z66494-1|CAA91262.2|  320|Caenorhabditis elegans Hypothetical
           protein C34C6.1 protein.
          Length = 320

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)
 Frame = -2

Query: 629 KLFILKDR*AVLSQSLCVLNIWIKPAF--ALLLHARFLSSLSCLRTPALF 486
           KL  L DR     +SLC  NI+I   F  A    A +    SC+ +  LF
Sbjct: 220 KLISLSDRIKSAEKSLCFSNIYISLTFLAAAASQALYAFCTSCMSSDLLF 269


>Z35662-1|CAA84721.1| 4307|Caenorhabditis elegans Hypothetical protein
            F25F2.2 protein.
          Length = 4307

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -1

Query: 279  FQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR 127
            F+R      P +ATPL S    +L SSS+G   P ++    P   +SLDS+
Sbjct: 4248 FEREKPPAIPAHATPLESV--LKLGSSSSGEEAPRNALYDDP---ISLDSQ 4293


>Z35599-4|CAA84661.1| 4307|Caenorhabditis elegans Hypothetical protein
            F25F2.2 protein.
          Length = 4307

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -1

Query: 279  FQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR 127
            F+R      P +ATPL S    +L SSS+G   P ++    P   +SLDS+
Sbjct: 4248 FEREKPPAIPAHATPLESV--LKLGSSSSGEEAPRNALYDDP---ISLDSQ 4293


>Z34802-10|CAA84339.1| 4307|Caenorhabditis elegans Hypothetical
            protein F25F2.2 protein.
          Length = 4307

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -1

Query: 279  FQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR 127
            F+R      P +ATPL S    +L SSS+G   P ++    P   +SLDS+
Sbjct: 4248 FEREKPPAIPAHATPLESV--LKLGSSSSGEEAPRNALYDDP---ISLDSQ 4293


>U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical
           protein C12D12.1b protein.
          Length = 648

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 19/78 (24%), Positives = 31/78 (39%)
 Frame = -1

Query: 375 TLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSS 196
           T+GT   APA++      P N  S+ T         S  T PT   P+ +       S++
Sbjct: 514 TIGTSPTAPANLTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPT-VPPVTTTTPTTTTSTT 572

Query: 195 TGSSFPADSPKPVPLAVV 142
           T ++    + +  P   V
Sbjct: 573 TTTTTTTTTTQTTPTTPV 590


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,092,837
Number of Sequences: 27780
Number of extensions: 351200
Number of successful extensions: 1095
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1042
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1094
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1560745544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).