SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF025467-10|AAB71040.2|  154|Caenorhabditis elegans He1 homologu...    36   0.018
Z92829-14|CAB07342.2|  337|Caenorhabditis elegans Hypothetical p...    30   1.2  
AL023838-4|CAA19504.1|  218|Caenorhabditis elegans Hypothetical ...    30   1.2  
Z77656-5|CAH04702.1|  308|Caenorhabditis elegans Hypothetical pr...    28   4.7  
Z50006-7|CAA90302.2| 1461|Caenorhabditis elegans Hypothetical pr...    28   6.2  
Z50004-4|CAA90293.2| 1461|Caenorhabditis elegans Hypothetical pr...    28   6.2  
AB066246-1|BAC05514.1| 1461|Caenorhabditis elegans ADT-1 protein.      28   6.2  

>AF025467-10|AAB71040.2|  154|Caenorhabditis elegans He1 homologue
           protein 1 protein.
          Length = 154

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = +1

Query: 310 DACTL-TSCPTEAGKTQTLDFSLHIGKKLPTGN-FEFKWKLWNEDNESQMC 456
           DACT    CP  AG+ Q  + S+ I +  P G   +  W+L   D+  ++C
Sbjct: 95  DACTYGVKCPVSAGENQIFEQSISITENHPAGEVIQVNWQLTRPDSGKEVC 145



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 5/65 (7%)
 Frame = +3

Query: 78  EFNVVTTRLCREVDASACTVNEVRIDPCV-----NSRLCHLKKGKNAKVSFDFTPQFSTT 242
           EF  +  ++C+    S  TV++V+ D C        ++C  KKG    +   F P   T 
Sbjct: 16  EFIEIGYKVCK----SDGTVSQVKADGCELTVKDGKKVCLFKKGSRPIIQIAFKPSKDTD 71

Query: 243 KLKTA 257
           KLKT+
Sbjct: 72  KLKTS 76


>Z92829-14|CAB07342.2|  337|Caenorhabditis elegans Hypothetical
           protein F10A3.8 protein.
          Length = 337

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)
 Frame = -1

Query: 254 GLEFSCGELWCK-----VERNLRVFPFLEVAQSTVNTGV 153
           G+ FSC + WCK      + +  +F  LE  + T NTGV
Sbjct: 54  GIYFSCCDFWCKPYVHMSKNSFAIFNVLEETKLTQNTGV 92


>AL023838-4|CAA19504.1|  218|Caenorhabditis elegans Hypothetical
           protein Y43C5A.4 protein.
          Length = 218

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +1

Query: 151 LTPVLTVDCATSRKGKTRRFLSTLHHNSPQLN 246
           LTP++T  C+   KGK ++ LS+ H      N
Sbjct: 31  LTPIITAQCSKKPKGKKKKKLSSSHEKKRSEN 62


>Z77656-5|CAH04702.1|  308|Caenorhabditis elegans Hypothetical
           protein F07B10.6 protein.
          Length = 308

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +1

Query: 397 TGNFEFKWKLWNEDNESQMCCY 462
           +G+F F ++L+N+D  SQ  C+
Sbjct: 59  SGHFVFNYQLFNDDKSSQAACF 80


>Z50006-7|CAA90302.2| 1461|Caenorhabditis elegans Hypothetical protein
            C02B4.1 protein.
          Length = 1461

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 129  CTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTP 227
            CT ++  ++PC +   CHL+ G  +  S D+TP
Sbjct: 1304 CTGSDFELNPCFDPARCHLRDGGWSTWS-DWTP 1335


>Z50004-4|CAA90293.2| 1461|Caenorhabditis elegans Hypothetical protein
            C02B4.1 protein.
          Length = 1461

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 129  CTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTP 227
            CT ++  ++PC +   CHL+ G  +  S D+TP
Sbjct: 1304 CTGSDFELNPCFDPARCHLRDGGWSTWS-DWTP 1335


>AB066246-1|BAC05514.1| 1461|Caenorhabditis elegans ADT-1 protein.
          Length = 1461

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 129  CTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTP 227
            CT ++  ++PC +   CHL+ G  +  S D+TP
Sbjct: 1304 CTGSDFELNPCFDPARCHLRDGGWSTWS-DWTP 1335


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,147,832
Number of Sequences: 27780
Number of extensions: 299624
Number of successful extensions: 752
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 737
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 752
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1353389824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).